BLASTX nr result
ID: Paeonia23_contig00015505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00015505 (275 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19325.1| hypothetical protein MIMGU_mgv1a003209mg [Mimulus... 56 5e-06 >gb|EYU19325.1| hypothetical protein MIMGU_mgv1a003209mg [Mimulus guttatus] Length = 600 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 272 ELESIKNAFKGRENKEAEMKRQLDLLQNSEAVAHKQKSFWT 150 ELE IKNAFK + K MKRQ++LLQNS AHK+KSFWT Sbjct: 539 ELEMIKNAFKSKMTKVETMKRQMELLQNSVEDAHKKKSFWT 579