BLASTX nr result
ID: Paeonia23_contig00015116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00015116 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi... 68 1e-09 emb|CAD56221.1| hypothetical protein [Cicer arietinum] 64 3e-08 >ref|XP_003626141.1| RNA-binding protein [Medicago truncatula] gi|355501156|gb|AES82359.1| RNA-binding protein [Medicago truncatula] Length = 454 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +2 Query: 35 LLEYSTVFITLLASTTYFMHNTKVQVIAEQEHKIQTEV*EIQKVFFCDLCNK 190 +L S F L+AS+ F+HN K+QV+AE+E KIQTEV EI+KVFFC+LCNK Sbjct: 265 ILRISCSFYYLVASSACFVHNLKIQVLAEREQKIQTEVKEIRKVFFCELCNK 316 >emb|CAD56221.1| hypothetical protein [Cicer arietinum] Length = 206 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/52 (57%), Positives = 40/52 (76%) Frame = +2 Query: 35 LLEYSTVFITLLASTTYFMHNTKVQVIAEQEHKIQTEV*EIQKVFFCDLCNK 190 +L S F L+AS+ F+H K+QV+AE+E KIQTEV EI+KVF+C+LCNK Sbjct: 17 ILRISCSFYYLVASSACFVHIMKIQVLAEREQKIQTEVKEIRKVFYCELCNK 68