BLASTX nr result
ID: Paeonia23_contig00015084
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00015084 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007050813.1| Phototropic-responsive NPH3 family protein i... 60 4e-07 ref|XP_007050812.1| Phototropic-responsive NPH3 family protein i... 60 4e-07 gb|EXC34714.1| BTB/POZ domain-containing protein [Morus notabilis] 58 1e-06 ref|XP_006389692.1| hypothetical protein POPTR_0020s00510g [Popu... 58 1e-06 ref|XP_002320358.1| hypothetical protein POPTR_0014s12800g [Popu... 58 1e-06 ref|XP_004170411.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma... 56 6e-06 ref|XP_004136051.1| PREDICTED: BTB/POZ domain-containing protein... 56 6e-06 ref|XP_002520669.1| protein binding protein, putative [Ricinus c... 56 6e-06 >ref|XP_007050813.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma cacao] gi|508703074|gb|EOX94970.1| Phototropic-responsive NPH3 family protein isoform 2 [Theobroma cacao] Length = 626 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 134 IVITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 + ITL N+A L C ++FLEMTEE +KNLE++T+ YLK+MVLPN Sbjct: 97 VEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYLKDMVLPN 140 >ref|XP_007050812.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma cacao] gi|508703073|gb|EOX94969.1| Phototropic-responsive NPH3 family protein isoform 1 [Theobroma cacao] Length = 631 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = -3 Query: 134 IVITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 + ITL N+A L C ++FLEMTEE +KNLE++T+ YLK+MVLPN Sbjct: 102 VEITLSNVAMLRCASHFLEMTEEFAEKNLEARTEAYLKDMVLPN 145 >gb|EXC34714.1| BTB/POZ domain-containing protein [Morus notabilis] Length = 631 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -3 Query: 134 IVITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 + IT N+A LCC +FLEMTE+ +KNLE++ + YLK MVLPN Sbjct: 102 VEITQSNVAMLCCAAHFLEMTEDFAEKNLEARVEAYLKEMVLPN 145 >ref|XP_006389692.1| hypothetical protein POPTR_0020s00510g [Populus trichocarpa] gi|550312574|gb|ERP48606.1| hypothetical protein POPTR_0020s00510g [Populus trichocarpa] Length = 631 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = -3 Query: 128 ITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 IT N+A LCC FLEMTE++ +KNLE++ + YLK MVLPN Sbjct: 104 ITQSNVAMLCCTARFLEMTEDLAEKNLEARAEAYLKEMVLPN 145 >ref|XP_002320358.1| hypothetical protein POPTR_0014s12800g [Populus trichocarpa] gi|222861131|gb|EEE98673.1| hypothetical protein POPTR_0014s12800g [Populus trichocarpa] Length = 632 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = -3 Query: 134 IVITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 + IT N+A LCC +FLEMTE+ +KNLE++ + YLK MVLPN Sbjct: 102 VEITQSNVAMLCCAAHFLEMTEDFAEKNLEARAEAYLKEMVLPN 145 >ref|XP_004170411.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At1g03010-like [Cucumis sativus] Length = 675 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = -3 Query: 134 IVITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 + ITL N+A L C +++LEMTEE D+NLE++T+ YLK +V PN Sbjct: 145 VEITLSNVAMLRCASHYLEMTEEFADRNLETRTEAYLKELVFPN 188 >ref|XP_004136051.1| PREDICTED: BTB/POZ domain-containing protein At1g03010-like [Cucumis sativus] Length = 675 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 34/44 (77%) Frame = -3 Query: 134 IVITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 + ITL N+A L C +++LEMTEE D+NLE++T+ YLK +V PN Sbjct: 145 VEITLSNVAMLRCASHYLEMTEEFADRNLETRTEAYLKELVFPN 188 >ref|XP_002520669.1| protein binding protein, putative [Ricinus communis] gi|223540054|gb|EEF41631.1| protein binding protein, putative [Ricinus communis] Length = 631 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 134 IVITLPNIAKLCCETNFLEMTEEVMDKNLESKTKVYLKNMVLPN 3 + ITL N+A + C +FLEMTE+ +KNLE++ + YLK MVLPN Sbjct: 102 VEITLSNVAMILCAAHFLEMTEDFAEKNLEARAEAYLKEMVLPN 145