BLASTX nr result
ID: Paeonia23_contig00014961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00014961 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526938.1| hypothetical protein RCOM_0530890 [Ricinus c... 40 5e-06 >ref|XP_002526938.1| hypothetical protein RCOM_0530890 [Ricinus communis] gi|223533690|gb|EEF35425.1| hypothetical protein RCOM_0530890 [Ricinus communis] Length = 180 Score = 40.0 bits (92), Expect(3) = 5e-06 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 10/52 (19%) Frame = +3 Query: 207 NHSKFTQEYGQPSYIEVHEHPRANLKAKQKGTHK----------KMKSWRVV 332 NHSKFT + G+P H HP K K KGT K ++ SWRVV Sbjct: 51 NHSKFTGKCGKPRCNGCHMHPSCKSKDKTKGTQKLKSHDVLSNYRLMSWRVV 102 Score = 32.0 bits (71), Expect(3) = 5e-06 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +1 Query: 133 ESRFIDKFDSSPIAELFTKV 192 +SRFI++FDS P A LFTKV Sbjct: 26 DSRFINRFDSPPTAGLFTKV 45 Score = 23.1 bits (48), Expect(3) = 5e-06 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 110 ILPLPWDSNPDS 145 ILP PW+ PDS Sbjct: 16 ILPSPWNPRPDS 27