BLASTX nr result
ID: Paeonia23_contig00014888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00014888 (412 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281414.2| PREDICTED: methyl-CpG-binding domain-contain... 61 1e-07 emb|CAN67324.1| hypothetical protein VITISV_012829 [Vitis vinifera] 61 1e-07 ref|XP_007207835.1| hypothetical protein PRUPE_ppa023402mg [Prun... 60 3e-07 ref|XP_006488261.1| PREDICTED: methyl-CpG-binding domain-contain... 59 5e-07 ref|XP_006424754.1| hypothetical protein CICLE_v10028859mg [Citr... 59 5e-07 ref|XP_006424752.1| hypothetical protein CICLE_v10028859mg [Citr... 59 5e-07 ref|XP_006424751.1| hypothetical protein CICLE_v10028859mg [Citr... 59 5e-07 ref|XP_004487033.1| PREDICTED: methyl-CpG-binding domain-contain... 59 7e-07 ref|XP_007206215.1| hypothetical protein PRUPE_ppa015252mg [Prun... 58 1e-06 ref|XP_002533112.1| hypothetical protein RCOM_0391080 [Ricinus c... 58 2e-06 ref|XP_006363366.1| PREDICTED: methyl-CpG-binding domain-contain... 57 2e-06 ref|XP_004251455.1| PREDICTED: methyl-CpG-binding domain-contain... 57 2e-06 >ref|XP_002281414.2| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Vitis vinifera] gi|297746130|emb|CBI16186.3| unnamed protein product [Vitis vinifera] Length = 212 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K SS + KTS+ KPP K+ WVL GPG D W P + VP+S KQ WAKIF+ VN Sbjct: 150 KNNSSTKVKTSTSHFIKPPKKVNWVLTGPGGDVWSPYINASAVPESIKQTWAKIFMLHVN 209 >emb|CAN67324.1| hypothetical protein VITISV_012829 [Vitis vinifera] Length = 212 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/60 (51%), Positives = 37/60 (61%), Gaps = 1/60 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K SS + KTS+ KPP K+ WVL GPG D W P + VP+S KQ WAKIF+ VN Sbjct: 150 KNNSSTKVKTSTSHFIKPPKKVNWVLTGPGGDVWSPYINASAVPESIKQTWAKIFMLHVN 209 >ref|XP_007207835.1| hypothetical protein PRUPE_ppa023402mg [Prunus persica] gi|462403477|gb|EMJ09034.1| hypothetical protein PRUPE_ppa023402mg [Prunus persica] Length = 142 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPGDA-WCPLMGGLMVPDSEKQQWAKIFVSTVN 178 + I+ + S + G+PP K++WVL GPG W P M VPDS Q+W+K FVS++ Sbjct: 74 RNITGANDRPSKLNFGRPPAKVKWVLGGPGGCMWNPFMDESKVPDSVLQKWSKTFVSSLY 133 Query: 179 YRNSNAPS 202 N APS Sbjct: 134 GGNIGAPS 141 >ref|XP_006488261.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Citrus sinensis] Length = 313 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/60 (43%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++N Sbjct: 251 KDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSIN 310 >ref|XP_006424754.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526688|gb|ESR37994.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] Length = 238 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/60 (43%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++N Sbjct: 176 KDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSIN 235 >ref|XP_006424752.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|567864208|ref|XP_006424753.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526686|gb|ESR37992.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526687|gb|ESR37993.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] Length = 315 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/60 (43%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++N Sbjct: 253 KDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSIN 312 >ref|XP_006424751.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] gi|557526685|gb|ESR37991.1| hypothetical protein CICLE_v10028859mg [Citrus clementina] Length = 169 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/60 (43%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPG-DAWCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K + + A S+ ++ PP K++WVL GPG + W LM +VPDS KQ+W++IFV ++N Sbjct: 107 KDVLTKGANASTLNIASPPAKVKWVLGGPGGNVWNALMNESVVPDSVKQEWSEIFVFSIN 166 >ref|XP_004487033.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Cicer arietinum] Length = 222 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/59 (38%), Positives = 38/59 (64%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPGDAWCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K + + + S +L +PP K+ WVL GPG W P + +VP+SEK +W+K F++++N Sbjct: 159 KNNTGEDDRGSVHNLTRPPTKVSWVLAGPGGLWNPFLDDSLVPESEKLKWSKAFITSIN 217 >ref|XP_007206215.1| hypothetical protein PRUPE_ppa015252mg [Prunus persica] gi|462401857|gb|EMJ07414.1| hypothetical protein PRUPE_ppa015252mg [Prunus persica] Length = 183 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/68 (44%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +2 Query: 2 KTISSHEAKTSSFDLGKPPLKIRWVLQGPGDA-WCPLMGGLMVPDSEKQQWAKIFVSTVN 178 K IS + S + G P K+ WVL G G + W P M VPDS KQ+W++IFVS + Sbjct: 115 KNISGENDRPSMLNFGIPTAKVNWVLGGTGGSMWNPFMEDSKVPDSVKQKWSEIFVSAIY 174 Query: 179 YRNSNAPS 202 N +APS Sbjct: 175 GGNISAPS 182 >ref|XP_002533112.1| hypothetical protein RCOM_0391080 [Ricinus communis] gi|223527103|gb|EEF29284.1| hypothetical protein RCOM_0391080 [Ricinus communis] Length = 176 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/58 (43%), Positives = 36/58 (62%) Frame = +2 Query: 8 ISSHEAKTSSFDLGKPPLKIRWVLQGPGDAWCPLMGGLMVPDSEKQQWAKIFVSTVNY 181 + H KTS DL PP++I+WVL G+AW PL+ + +S K +W + FV T+NY Sbjct: 118 LGEHTVKTSLVDLHNPPVRIKWVLGPRGNAWSPLIDDTRILESVKHKWFETFVWTLNY 175 >ref|XP_006363366.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Solanum tuberosum] Length = 291 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +2 Query: 53 PPLKIRWVLQGP-GDAWCPLMGGLMVPDSEKQQWAKIFVSTVNYRNSNA 196 PP K+ WVL P GDAW P + G +PDS KQQW K F+ +N N NA Sbjct: 239 PPAKVNWVLSSPKGDAWNPFIAGTPIPDSVKQQWTKRFMLFMNGENLNA 287 >ref|XP_004251455.1| PREDICTED: methyl-CpG-binding domain-containing protein 7-like [Solanum lycopersicum] Length = 285 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 1/49 (2%) Frame = +2 Query: 53 PPLKIRWVLQGP-GDAWCPLMGGLMVPDSEKQQWAKIFVSTVNYRNSNA 196 PP K+ WVL P GDAW PL+ G +PDS KQQW K F +N N NA Sbjct: 233 PPAKVNWVLSSPKGDAWNPLISGTPIPDSLKQQWTKRFKLFMNDENLNA 281