BLASTX nr result
ID: Paeonia23_contig00014838
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00014838 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301628.2| hypothetical protein POPTR_0002s23070g [Popu... 56 6e-06 >ref|XP_002301628.2| hypothetical protein POPTR_0002s23070g [Populus trichocarpa] gi|550345647|gb|EEE80901.2| hypothetical protein POPTR_0002s23070g [Populus trichocarpa] Length = 87 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/55 (52%), Positives = 38/55 (69%) Frame = -1 Query: 436 QVIEKFPKMKHQIEEDMQPQVLLYKKLWLEAEAEMLSVKYKDSLVRMKRR*IKSK 272 QV EK + +++EE+ PQVLLYK LWLEAEA + S+KYK S++ MK K K Sbjct: 29 QVNEKALEGHYELEEEENPQVLLYKNLWLEAEAALCSMKYKASVLGMKTEMAKIK 83