BLASTX nr result
ID: Paeonia23_contig00014782
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00014782 (419 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007023154.1| Squamous cell carcinoma antigen recognized b... 62 6e-08 ref|XP_002527822.1| Squamous cell carcinoma antigen recognized b... 62 6e-08 ref|XP_006470935.1| PREDICTED: squamous cell carcinoma antigen r... 61 2e-07 ref|XP_006470843.1| PREDICTED: squamous cell carcinoma antigen r... 61 2e-07 ref|XP_006431430.1| hypothetical protein CICLE_v10000238mg [Citr... 61 2e-07 ref|XP_006431429.1| hypothetical protein CICLE_v10000238mg [Citr... 61 2e-07 ref|XP_006431428.1| hypothetical protein CICLE_v10000238mg [Citr... 61 2e-07 ref|XP_006431427.1| hypothetical protein CICLE_v10000238mg [Citr... 61 2e-07 gb|EYU35044.1| hypothetical protein MIMGU_mgv1a016245mg [Mimulus... 60 3e-07 ref|XP_006385096.1| hypothetical protein POPTR_0004s23880g [Popu... 59 5e-07 ref|XP_007226168.1| hypothetical protein PRUPE_ppa015319mg, part... 57 2e-06 ref|XP_004230407.1| PREDICTED: squamous cell carcinoma antigen r... 56 5e-06 ref|XP_006836925.1| hypothetical protein AMTR_s00099p00147110 [A... 56 6e-06 >ref|XP_007023154.1| Squamous cell carcinoma antigen recognized by T-cells 3 [Theobroma cacao] gi|508778520|gb|EOY25776.1| Squamous cell carcinoma antigen recognized by T-cells 3 [Theobroma cacao] Length = 842 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 110 ENLQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 E LQTLE ELS NPSNYD HVQYIKLLR+ GEIEKL Sbjct: 51 EQLQTLESELSTNPSNYDAHVQYIKLLRKRGEIEKL 86 >ref|XP_002527822.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] gi|223532746|gb|EEF34525.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] Length = 852 Score = 62.4 bits (150), Expect = 6e-08 Identities = 36/85 (42%), Positives = 49/85 (57%) Frame = -1 Query: 257 SMAETLESKLLETNLPSCKEVPNESDVLQENXXXXXXXXXXXXXXXEAQENLQTLELELS 78 S ++ L+SK + S + ++SD E+ E L++LE ELS Sbjct: 30 SKSQNLQSKPNSISYSSSSDSSDDSDADSEDESHQ-------------NEQLKSLEAELS 76 Query: 77 NNPSNYDTHVQYIKLLRRLGEIEKL 3 +NPSNYD HVQYIKLLR++GEIEKL Sbjct: 77 SNPSNYDAHVQYIKLLRKMGEIEKL 101 >ref|XP_006470935.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Citrus sinensis] Length = 845 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 LQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 LQTL+ +LSN PSNYDTHVQYIK+LR++GEIEKL Sbjct: 68 LQTLQYQLSNEPSNYDTHVQYIKVLRKMGEIEKL 101 >ref|XP_006470843.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Citrus sinensis] Length = 156 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 LQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 LQTL+ +LSN PSNYDTHVQYIK+LR++GEIEKL Sbjct: 64 LQTLQYQLSNEPSNYDTHVQYIKVLRKMGEIEKL 97 >ref|XP_006431430.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] gi|557533552|gb|ESR44670.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] Length = 849 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 LQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 LQTL+ +LSN PSNYDTHVQYIK+LR++GEIEKL Sbjct: 64 LQTLQYQLSNEPSNYDTHVQYIKVLRKMGEIEKL 97 >ref|XP_006431429.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] gi|557533551|gb|ESR44669.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] Length = 871 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 LQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 LQTL+ +LSN PSNYDTHVQYIK+LR++GEIEKL Sbjct: 64 LQTLQYQLSNEPSNYDTHVQYIKVLRKMGEIEKL 97 >ref|XP_006431428.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] gi|557533550|gb|ESR44668.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] Length = 683 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 LQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 LQTL+ +LSN PSNYDTHVQYIK+LR++GEIEKL Sbjct: 3 LQTLQYQLSNEPSNYDTHVQYIKVLRKMGEIEKL 36 >ref|XP_006431427.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] gi|557533549|gb|ESR44667.1| hypothetical protein CICLE_v10000238mg [Citrus clementina] Length = 661 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -1 Query: 104 LQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 LQTL+ +LSN PSNYDTHVQYIK+LR++GEIEKL Sbjct: 3 LQTLQYQLSNEPSNYDTHVQYIKVLRKMGEIEKL 36 >gb|EYU35044.1| hypothetical protein MIMGU_mgv1a016245mg [Mimulus guttatus] Length = 129 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = -1 Query: 116 AQENLQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 A+ +++L+ ELSNNPSNYDTHVQYIK+LR+ G+IEKL Sbjct: 31 AKAQIESLQTELSNNPSNYDTHVQYIKILRKQGDIEKL 68 >ref|XP_006385096.1| hypothetical protein POPTR_0004s23880g [Populus trichocarpa] gi|550341864|gb|ERP62893.1| hypothetical protein POPTR_0004s23880g [Populus trichocarpa] Length = 843 Score = 59.3 bits (142), Expect = 5e-07 Identities = 35/81 (43%), Positives = 47/81 (58%), Gaps = 2/81 (2%) Frame = -1 Query: 239 ESKLLETNLPSCKEVPNESDVLQENXXXXXXXXXXXXXXXEAQEN--LQTLELELSNNPS 66 E K LE L N++ +N E+Q+N L+TLE ELS+NP+ Sbjct: 6 EDKTLEEELDDEDNNNNDNGDQLQNPKLRSDSDSDSDSEDESQQNQELKTLETELSSNPA 65 Query: 65 NYDTHVQYIKLLRRLGEIEKL 3 NYD+H QYIKLLR++GEI+KL Sbjct: 66 NYDSHAQYIKLLRKMGEIDKL 86 >ref|XP_007226168.1| hypothetical protein PRUPE_ppa015319mg, partial [Prunus persica] gi|462423104|gb|EMJ27367.1| hypothetical protein PRUPE_ppa015319mg, partial [Prunus persica] Length = 409 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/40 (70%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = -1 Query: 116 AQENLQ--TLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 AQ+NLQ TLE ELS NP NYD HVQYIK+LR++ +IEKL Sbjct: 50 AQKNLQLQTLEAELSTNPGNYDAHVQYIKILRQIADIEKL 89 >ref|XP_004230407.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Solanum lycopersicum] Length = 856 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = -1 Query: 116 AQEN--LQTLELELSNNPSNYDTHVQYIKLLRRLGEIEKL 3 AQ+N +Q LE EL NNPSNYDTHVQYIK R+ G+IEKL Sbjct: 55 AQQNTQIQALETELLNNPSNYDTHVQYIKASRKQGDIEKL 94 >ref|XP_006836925.1| hypothetical protein AMTR_s00099p00147110 [Amborella trichopoda] gi|548839489|gb|ERM99778.1| hypothetical protein AMTR_s00099p00147110 [Amborella trichopoda] Length = 761 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/85 (34%), Positives = 48/85 (56%) Frame = -1 Query: 257 SMAETLESKLLETNLPSCKEVPNESDVLQENXXXXXXXXXXXXXXXEAQENLQTLELELS 78 S+ ETLE+K ++ + + ++ + D+ E + ++ L+TLE ++ Sbjct: 19 SIGETLETKQIDPSQYAYEDFEDADDLSSEEHGRKSSSSDSESEEEDKEKVLETLEKAVA 78 Query: 77 NNPSNYDTHVQYIKLLRRLGEIEKL 3 NP YD+HVQYIK LR++G IEKL Sbjct: 79 ENPREYDSHVQYIKALRKVGHIEKL 103