BLASTX nr result
ID: Paeonia23_contig00014713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00014713 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307814.2| hypothetical protein POPTR_0005s27700g, part... 58 1e-06 gb|ABK92910.1| unknown [Populus trichocarpa] 58 1e-06 gb|EPS63952.1| hypothetical protein M569_10834, partial [Genlise... 57 3e-06 ref|XP_006435427.1| hypothetical protein CICLE_v10003083mg [Citr... 56 6e-06 >ref|XP_002307814.2| hypothetical protein POPTR_0005s27700g, partial [Populus trichocarpa] gi|550339881|gb|EEE94810.2| hypothetical protein POPTR_0005s27700g, partial [Populus trichocarpa] Length = 97 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +3 Query: 3 FMRGEPLVRKMAVLARLVVFPGAMVAALVYSPPEYL-SKKDDS 128 FM+GEPLV K+A +A+ VFP AM AAL YSPP+Y+ SKKD+S Sbjct: 53 FMKGEPLVAKLAAIAKFGVFPAAMAAALFYSPPDYVFSKKDNS 95 >gb|ABK92910.1| unknown [Populus trichocarpa] Length = 48 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +3 Query: 3 FMRGEPLVRKMAVLARLVVFPGAMVAALVYSPPEYL-SKKDDS 128 FM+GEPLV K+A +A+ VFP AM AAL YSPP+Y+ SKKD+S Sbjct: 4 FMKGEPLVAKLAAIAKFGVFPAAMAAALFYSPPDYVFSKKDNS 46 >gb|EPS63952.1| hypothetical protein M569_10834, partial [Genlisea aurea] Length = 54 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/41 (56%), Positives = 34/41 (82%) Frame = +3 Query: 6 MRGEPLVRKMAVLARLVVFPGAMVAALVYSPPEYLSKKDDS 128 ++G+PLV K++ L++ VVFPG M+AAL+YSPP+Y+S K S Sbjct: 6 LKGQPLVTKLSALSQYVVFPGVMIAALIYSPPDYVSSKKKS 46 >ref|XP_006435427.1| hypothetical protein CICLE_v10003083mg [Citrus clementina] gi|557537549|gb|ESR48667.1| hypothetical protein CICLE_v10003083mg [Citrus clementina] Length = 48 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +3 Query: 6 MRGEPLVRKMAVLARLVVFPGAMVAALVYSPPEYLSKKDDSK 131 MRGEPLV K+A LA+ V+ PG+M AAL+YSPP+Y S K Sbjct: 4 MRGEPLVAKLAALAKYVILPGSMAAALIYSPPQYGSSTKSQK 45