BLASTX nr result
ID: Paeonia23_contig00014508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00014508 (252 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509718.1| cytochrome P450, putative [Ricinus communis]... 58 1e-06 gb|EXC34109.1| Cytochrome P450 87A3 [Morus notabilis] 55 8e-06 >ref|XP_002509718.1| cytochrome P450, putative [Ricinus communis] gi|223549617|gb|EEF51105.1| cytochrome P450, putative [Ricinus communis] Length = 544 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -3 Query: 250 YTIPKG*MVMVCLAAIYLNLTKYEDPLSFNFWRWEE 143 YTIP G VMVC A++LN TKYEDPLSFN WRW++ Sbjct: 364 YTIPAGWAVMVCPPAVHLNRTKYEDPLSFNPWRWKD 399 >gb|EXC34109.1| Cytochrome P450 87A3 [Morus notabilis] Length = 479 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -3 Query: 250 YTIPKG*MVMVCLAAIYLNLTKYEDPLSFNFWRWE 146 YTIP G VMVC A++LN KYEDPL+FN WRWE Sbjct: 364 YTIPAGWAVMVCPPAVHLNPAKYEDPLAFNPWRWE 398