BLASTX nr result
ID: Paeonia23_contig00014373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00014373 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008578214.1| ribosomal protein L2 (chloroplast) [Stockwel... 73 5e-11 ref|YP_008578129.1| ribosomal protein L2 (chloroplast) [Allosync... 73 5e-11 ref|YP_008577279.1| ribosomal protein L2 (chloroplast) [Eucalypt... 73 5e-11 ref|YP_008575154.1| ribosomal protein L2 (chloroplast) [Eucalypt... 73 5e-11 ref|YP_636340.1| ribosomal protein L2 [Eucalyptus globulus subsp... 73 5e-11 gb|AFB70641.1| 50S ribosomal protein L2, partial (chloroplast) [... 73 5e-11 gb|AEK71589.1| ribosomal protein L2 [Terminalia catappa] 73 5e-11 gb|AHI87570.1| 50S ribosomal protein L2 (chloroplast) [Chionogra... 72 6e-11 gb|AHB86315.1| 50S ribosomal protein L2 (chloroplast) [Veratrum ... 72 6e-11 ref|YP_008758250.1| 50S ribosomal protein L2 (chloroplast) [Vera... 72 6e-11 gb|AEK71473.1| ribosomal protein L2 [Eucryphia lucida] 72 6e-11 ref|YP_665619.1| ribosomal protein L2 [Populus alba] gi|12224340... 72 6e-11 ref|YP_665599.1| ribosomal protein L2 [Populus alba] gi|12223094... 72 6e-11 gb|AHA12721.1| ribosomal protein L2 [Orchidantha fimbriata] 72 8e-11 ref|YP_053196.1| ribosomal protein L2 [Nymphaea alba] gi|5034685... 72 8e-11 gb|AFG25638.1| ribosomal protein L2, partial [Apostasia wallichii] 72 8e-11 gb|AEK71537.1| ribosomal protein L2 [Phyllanthus calycinus] 72 8e-11 gb|AEK71530.1| ribosomal protein L2 [Ochna mossambicensis] 72 8e-11 ref|YP_002720176.1| rpl2 [Jatropha curcas] gi|224979627|gb|ACN72... 72 8e-11 ref|YP_002720153.1| rpl2 [Jatropha curcas] gi|224979605|gb|ACN72... 72 8e-11 >ref|YP_008578214.1| ribosomal protein L2 (chloroplast) [Stockwellia quadrifida] gi|545719319|ref|YP_008578237.1| ribosomal protein L2 (chloroplast) [Stockwellia quadrifida] gi|442569462|gb|AGC59623.1| ribosomal protein L2 (chloroplast) [Stockwellia quadrifida] gi|442569485|gb|AGC59646.1| ribosomal protein L2 (chloroplast) [Stockwellia quadrifida] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_008578129.1| ribosomal protein L2 (chloroplast) [Allosyncarpia ternata] gi|545719491|ref|YP_008578152.1| ribosomal protein L2 (chloroplast) [Allosyncarpia ternata] gi|442569376|gb|AGC59538.1| ribosomal protein L2 (chloroplast) [Allosyncarpia ternata] gi|442569399|gb|AGC59561.1| ribosomal protein L2 (chloroplast) [Allosyncarpia ternata] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_008577279.1| ribosomal protein L2 (chloroplast) [Eucalyptus salmonophloia] gi|545718459|ref|YP_008577302.1| ribosomal protein L2 (chloroplast) [Eucalyptus salmonophloia] gi|545718522|ref|YP_008577364.1| ribosomal protein L2 (chloroplast) [Eucalyptus microcorys] gi|545718545|ref|YP_008577387.1| ribosomal protein L2 (chloroplast) [Eucalyptus microcorys] gi|545718608|ref|YP_008577449.1| ribosomal protein L2 (chloroplast) [Eucalyptus guilfoylei] gi|545718631|ref|YP_008577472.1| ribosomal protein L2 (chloroplast) [Eucalyptus guilfoylei] gi|442568516|gb|AGC58688.1| ribosomal protein L2 (chloroplast) [Eucalyptus salmonophloia] gi|442568539|gb|AGC58711.1| ribosomal protein L2 (chloroplast) [Eucalyptus salmonophloia] gi|442568602|gb|AGC58773.1| ribosomal protein L2 (chloroplast) [Eucalyptus microcorys] gi|442568625|gb|AGC58796.1| ribosomal protein L2 (chloroplast) [Eucalyptus microcorys] gi|442568688|gb|AGC58858.1| ribosomal protein L2 (chloroplast) [Eucalyptus guilfoylei] gi|442568711|gb|AGC58881.1| ribosomal protein L2 (chloroplast) [Eucalyptus guilfoylei] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_008575154.1| ribosomal protein L2 (chloroplast) [Eucalyptus obliqua] gi|545716309|ref|YP_008575177.1| ribosomal protein L2 (chloroplast) [Eucalyptus obliqua] gi|545716372|ref|YP_008575239.1| ribosomal protein L2 (chloroplast) [Eucalyptus radiata] gi|545716395|ref|YP_008575262.1| ribosomal protein L2 (chloroplast) [Eucalyptus radiata] gi|545716458|ref|YP_008575324.1| ribosomal protein L2 (chloroplast) [Eucalyptus delegatensis] gi|545716481|ref|YP_008575347.1| ribosomal protein L2 (chloroplast) [Eucalyptus delegatensis] gi|545716544|ref|YP_008575409.1| ribosomal protein L2 (chloroplast) [Eucalyptus verrucata] gi|545716567|ref|YP_008575432.1| ribosomal protein L2 (chloroplast) [Eucalyptus verrucata] gi|545716630|ref|YP_008575494.1| ribosomal protein L2 (chloroplast) [Eucalyptus baxteri] gi|545716653|ref|YP_008575517.1| ribosomal protein L2 (chloroplast) [Eucalyptus baxteri] gi|545716716|ref|YP_008575579.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversifolia] gi|545716739|ref|YP_008575602.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversifolia] gi|545716802|ref|YP_008575664.1| ribosomal protein L2 (chloroplast) [Eucalyptus sieberi] gi|545716825|ref|YP_008575687.1| ribosomal protein L2 (chloroplast) [Eucalyptus sieberi] gi|545716888|ref|YP_008575749.1| ribosomal protein L2 (chloroplast) [Eucalyptus elata] gi|545716911|ref|YP_008575772.1| ribosomal protein L2 (chloroplast) [Eucalyptus elata] gi|545716974|ref|YP_008575834.1| ribosomal protein L2 (chloroplast) [Eucalyptus regnans] gi|545716997|ref|YP_008575857.1| ribosomal protein L2 (chloroplast) [Eucalyptus regnans] gi|545717060|ref|YP_008575919.1| ribosomal protein L2 (chloroplast) [Eucalyptus umbra] gi|545717083|ref|YP_008575942.1| ribosomal protein L2 (chloroplast) [Eucalyptus umbra] gi|545717146|ref|YP_008576004.1| ribosomal protein L2 (chloroplast) [Eucalyptus cloeziana] gi|545717169|ref|YP_008576027.1| ribosomal protein L2 (chloroplast) [Eucalyptus cloeziana] gi|545717232|ref|YP_008576089.1| ribosomal protein L2 (chloroplast) [Eucalyptus patens] gi|545717255|ref|YP_008576112.1| ribosomal protein L2 (chloroplast) [Eucalyptus patens] gi|545717318|ref|YP_008576174.1| ribosomal protein L2 (chloroplast) [Eucalyptus marginata] gi|545717341|ref|YP_008576197.1| ribosomal protein L2 (chloroplast) [Eucalyptus marginata] gi|442566194|gb|AGC56393.1| ribosomal protein L2 (chloroplast) [Eucalyptus obliqua] gi|442566217|gb|AGC56416.1| ribosomal protein L2 (chloroplast) [Eucalyptus obliqua] gi|442566280|gb|AGC56478.1| ribosomal protein L2 (chloroplast) [Eucalyptus radiata] gi|442566303|gb|AGC56501.1| ribosomal protein L2 (chloroplast) [Eucalyptus radiata] gi|442566366|gb|AGC56563.1| ribosomal protein L2 (chloroplast) [Eucalyptus delegatensis] gi|442566389|gb|AGC56586.1| ribosomal protein L2 (chloroplast) [Eucalyptus delegatensis] gi|442566452|gb|AGC56648.1| ribosomal protein L2 (chloroplast) [Eucalyptus verrucata] gi|442566475|gb|AGC56671.1| ribosomal protein L2 (chloroplast) [Eucalyptus verrucata] gi|442566538|gb|AGC56733.1| ribosomal protein L2 (chloroplast) [Eucalyptus baxteri] gi|442566561|gb|AGC56756.1| ribosomal protein L2 (chloroplast) [Eucalyptus baxteri] gi|442566624|gb|AGC56818.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversifolia] gi|442566647|gb|AGC56841.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversifolia] gi|442566710|gb|AGC56903.1| ribosomal protein L2 (chloroplast) [Eucalyptus sieberi] gi|442566733|gb|AGC56926.1| ribosomal protein L2 (chloroplast) [Eucalyptus sieberi] gi|442566796|gb|AGC56988.1| ribosomal protein L2 (chloroplast) [Eucalyptus elata] gi|442566819|gb|AGC57011.1| ribosomal protein L2 (chloroplast) [Eucalyptus elata] gi|442566882|gb|AGC57073.1| ribosomal protein L2 (chloroplast) [Eucalyptus regnans] gi|442566905|gb|AGC57096.1| ribosomal protein L2 (chloroplast) [Eucalyptus regnans] gi|442566968|gb|AGC57158.1| ribosomal protein L2 (chloroplast) [Eucalyptus umbra] gi|442566991|gb|AGC57181.1| ribosomal protein L2 (chloroplast) [Eucalyptus umbra] gi|442567054|gb|AGC57243.1| ribosomal protein L2 (chloroplast) [Eucalyptus cloeziana] gi|442567077|gb|AGC57266.1| ribosomal protein L2 (chloroplast) [Eucalyptus cloeziana] gi|442567140|gb|AGC57328.1| ribosomal protein L2 (chloroplast) [Eucalyptus patens] gi|442567163|gb|AGC57351.1| ribosomal protein L2 (chloroplast) [Eucalyptus patens] gi|442567226|gb|AGC57413.1| ribosomal protein L2 (chloroplast) [Eucalyptus marginata] gi|442567249|gb|AGC57436.1| ribosomal protein L2 (chloroplast) [Eucalyptus marginata] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_636340.1| ribosomal protein L2 [Eucalyptus globulus subsp. globulus] gi|108802707|ref|YP_636363.1| ribosomal protein L2 [Eucalyptus globulus subsp. globulus] gi|545717404|ref|YP_008576259.1| ribosomal protein L2 (chloroplast) [Eucalyptus curtisii] gi|545717427|ref|YP_008576282.1| ribosomal protein L2 (chloroplast) [Eucalyptus curtisii] gi|545717490|ref|YP_008576344.1| ribosomal protein L2 (chloroplast) [Eucalyptus melliodora] gi|545717513|ref|YP_008576367.1| ribosomal protein L2 (chloroplast) [Eucalyptus melliodora] gi|545717576|ref|YP_008576429.1| ribosomal protein L2 (chloroplast) [Eucalyptus polybractea] gi|545717599|ref|YP_008576452.1| ribosomal protein L2 (chloroplast) [Eucalyptus polybractea] gi|545717662|ref|YP_008576514.1| ribosomal protein L2 (chloroplast) [Eucalyptus cladocalyx] gi|545717685|ref|YP_008576537.1| ribosomal protein L2 (chloroplast) [Eucalyptus cladocalyx] gi|545717748|ref|YP_008576599.1| ribosomal protein L2 (chloroplast) [Eucalyptus nitens] gi|545717771|ref|YP_008576622.1| ribosomal protein L2 (chloroplast) [Eucalyptus nitens] gi|545717834|ref|YP_008576684.1| ribosomal protein L2 (chloroplast) [Eucalyptus aromaphloia] gi|545717857|ref|YP_008576707.1| ribosomal protein L2 (chloroplast) [Eucalyptus aromaphloia] gi|545717920|ref|YP_008576769.1| ribosomal protein L2 (chloroplast) [Eucalyptus saligna] gi|545717943|ref|YP_008576792.1| ribosomal protein L2 (chloroplast) [Eucalyptus saligna] gi|545718006|ref|YP_008576854.1| ribosomal protein L2 (chloroplast) [Eucalyptus camaldulensis] gi|545718029|ref|YP_008576877.1| ribosomal protein L2 (chloroplast) [Eucalyptus camaldulensis] gi|545718092|ref|YP_008576939.1| ribosomal protein L2 (chloroplast) [Eucalyptus deglupta] gi|545718115|ref|YP_008576962.1| ribosomal protein L2 (chloroplast) [Eucalyptus deglupta] gi|545718178|ref|YP_008577024.1| ribosomal protein L2 (chloroplast) [Eucalyptus spathulata] gi|545718201|ref|YP_008577047.1| ribosomal protein L2 (chloroplast) [Eucalyptus spathulata] gi|545718264|ref|YP_008577109.1| ribosomal protein L2 (chloroplast) [Eucalyptus torquata] gi|545718287|ref|YP_008577132.1| ribosomal protein L2 (chloroplast) [Eucalyptus torquata] gi|545718350|ref|YP_008577194.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversicolor] gi|545718373|ref|YP_008577217.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversicolor] gi|545718694|ref|YP_008577534.1| ribosomal protein L2 (chloroplast) [Eucalyptus erythrocorys] gi|545718717|ref|YP_008577557.1| ribosomal protein L2 (chloroplast) [Eucalyptus erythrocorys] gi|545718780|ref|YP_008577619.1| ribosomal protein L2 (chloroplast) [Corymbia gummifera] gi|545718803|ref|YP_008577642.1| ribosomal protein L2 (chloroplast) [Corymbia gummifera] gi|545718866|ref|YP_008577704.1| ribosomal protein L2 (chloroplast) [Corymbia maculata] gi|545718889|ref|YP_008577727.1| ribosomal protein L2 (chloroplast) [Corymbia maculata] gi|545718952|ref|YP_008577789.1| ribosomal protein L2 (chloroplast) [Corymbia eximia] gi|545718975|ref|YP_008577812.1| ribosomal protein L2 (chloroplast) [Corymbia eximia] gi|545719038|ref|YP_008577874.1| ribosomal protein L2 (chloroplast) [Corymbia tessellaris] gi|545719061|ref|YP_008577897.1| ribosomal protein L2 (chloroplast) [Corymbia tessellaris] gi|545719124|ref|YP_008577959.1| ribosomal protein L2 (chloroplast) [Angophora floribunda] gi|545719147|ref|YP_008577982.1| ribosomal protein L2 (chloroplast) [Angophora floribunda] gi|545719210|ref|YP_008578044.1| ribosomal protein L2 (chloroplast) [Angophora costata] gi|545719233|ref|YP_008578067.1| ribosomal protein L2 (chloroplast) [Angophora costata] gi|118597126|sp|Q49KT4.1|RK2_EUCGG RecName: Full=50S ribosomal protein L2, chloroplastic gi|60460848|gb|AAX21068.1| ribosomal protein L2 [Eucalyptus globulus subsp. globulus] gi|60460873|gb|AAX21093.1| ribosomal protein L2 [Eucalyptus globulus subsp. globulus] gi|296936713|gb|ADH94385.1| ribosomal protein L2 [Syzygium cumini] gi|296936734|gb|ADH94406.1| ribosomal protein L2 [Syzygium cumini] gi|340842498|gb|AEK78157.1| ribosomal protein L2 [Myrtus communis] gi|442567312|gb|AGC57498.1| ribosomal protein L2 (chloroplast) [Eucalyptus curtisii] gi|442567335|gb|AGC57521.1| ribosomal protein L2 (chloroplast) [Eucalyptus curtisii] gi|442567398|gb|AGC57583.1| ribosomal protein L2 (chloroplast) [Eucalyptus melliodora] gi|442567421|gb|AGC57606.1| ribosomal protein L2 (chloroplast) [Eucalyptus melliodora] gi|442567484|gb|AGC57668.1| ribosomal protein L2 (chloroplast) [Eucalyptus melliodora] gi|442567507|gb|AGC57691.1| ribosomal protein L2 (chloroplast) [Eucalyptus melliodora] gi|442567570|gb|AGC57753.1| ribosomal protein L2 (chloroplast) [Eucalyptus polybractea] gi|442567593|gb|AGC57776.1| ribosomal protein L2 (chloroplast) [Eucalyptus polybractea] gi|442567656|gb|AGC57838.1| ribosomal protein L2 (chloroplast) [Eucalyptus cladocalyx] gi|442567679|gb|AGC57861.1| ribosomal protein L2 (chloroplast) [Eucalyptus cladocalyx] gi|442567742|gb|AGC57923.1| ribosomal protein L2 (chloroplast) [Eucalyptus globulus] gi|442567765|gb|AGC57946.1| ribosomal protein L2 (chloroplast) [Eucalyptus globulus] gi|442567828|gb|AGC58008.1| ribosomal protein L2 (chloroplast) [Eucalyptus nitens] gi|442567851|gb|AGC58031.1| ribosomal protein L2 (chloroplast) [Eucalyptus nitens] gi|442567914|gb|AGC58093.1| ribosomal protein L2 (chloroplast) [Eucalyptus aromaphloia] gi|442567937|gb|AGC58116.1| ribosomal protein L2 (chloroplast) [Eucalyptus aromaphloia] gi|442568000|gb|AGC58178.1| ribosomal protein L2 (chloroplast) [Eucalyptus saligna] gi|442568023|gb|AGC58201.1| ribosomal protein L2 (chloroplast) [Eucalyptus saligna] gi|442568086|gb|AGC58263.1| ribosomal protein L2 (chloroplast) [Eucalyptus camaldulensis] gi|442568109|gb|AGC58286.1| ribosomal protein L2 (chloroplast) [Eucalyptus camaldulensis] gi|442568172|gb|AGC58348.1| ribosomal protein L2 (chloroplast) [Eucalyptus deglupta] gi|442568195|gb|AGC58371.1| ribosomal protein L2 (chloroplast) [Eucalyptus deglupta] gi|442568258|gb|AGC58433.1| ribosomal protein L2 (chloroplast) [Eucalyptus spathulata] gi|442568281|gb|AGC58456.1| ribosomal protein L2 (chloroplast) [Eucalyptus spathulata] gi|442568344|gb|AGC58518.1| ribosomal protein L2 (chloroplast) [Eucalyptus torquata] gi|442568367|gb|AGC58541.1| ribosomal protein L2 (chloroplast) [Eucalyptus torquata] gi|442568430|gb|AGC58603.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversicolor] gi|442568453|gb|AGC58626.1| ribosomal protein L2 (chloroplast) [Eucalyptus diversicolor] gi|442568774|gb|AGC58943.1| ribosomal protein L2 (chloroplast) [Eucalyptus erythrocorys] gi|442568797|gb|AGC58966.1| ribosomal protein L2 (chloroplast) [Eucalyptus erythrocorys] gi|442568860|gb|AGC59028.1| ribosomal protein L2 (chloroplast) [Corymbia gummifera] gi|442568883|gb|AGC59051.1| ribosomal protein L2 (chloroplast) [Corymbia gummifera] gi|442568946|gb|AGC59113.1| ribosomal protein L2 (chloroplast) [Corymbia maculata] gi|442568969|gb|AGC59136.1| ribosomal protein L2 (chloroplast) [Corymbia maculata] gi|442569032|gb|AGC59198.1| ribosomal protein L2 (chloroplast) [Corymbia eximia] gi|442569055|gb|AGC59221.1| ribosomal protein L2 (chloroplast) [Corymbia eximia] gi|442569118|gb|AGC59283.1| ribosomal protein L2 (chloroplast) [Corymbia tessellaris] gi|442569141|gb|AGC59306.1| ribosomal protein L2 (chloroplast) [Corymbia tessellaris] gi|442569204|gb|AGC59368.1| ribosomal protein L2 (chloroplast) [Angophora floribunda] gi|442569227|gb|AGC59391.1| ribosomal protein L2 (chloroplast) [Angophora floribunda] gi|442569290|gb|AGC59453.1| ribosomal protein L2 (chloroplast) [Angophora costata] gi|442569313|gb|AGC59476.1| ribosomal protein L2 (chloroplast) [Angophora costata] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >gb|AFB70641.1| 50S ribosomal protein L2, partial (chloroplast) [Weingartia kargliana] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 41/69 (59%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = -1 Query: 205 FLSEEPQTEKPPLIKRKKNKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLY 29 + + P T K + K+ K S+ R KLIYG R KGRNARG++TA HRGGGHKRLY Sbjct: 6 YKTSTPSTRKGAVEKKVK----SNPRNKLIYGQRRCGKGRNARGIITAR-HRGGGHKRLY 60 Query: 28 RKIDFRRNK 2 RKIDFRRNK Sbjct: 61 RKIDFRRNK 69 >gb|AEK71589.1| ribosomal protein L2 [Terminalia catappa] Length = 274 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >gb|AHI87570.1| 50S ribosomal protein L2 (chloroplast) [Chionographis japonica] gi|584297245|gb|AHI87591.1| 50S ribosomal protein L2 (chloroplast) [Chionographis japonica] Length = 273 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 N++ S+ R LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 NQVKSNPRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >gb|AHB86315.1| 50S ribosomal protein L2 (chloroplast) [Veratrum patulum] Length = 273 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 N++ S+ R LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 NQVKSNPRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_008758250.1| 50S ribosomal protein L2 (chloroplast) [Veratrum patulum] gi|556927290|ref|YP_008758229.1| 50S ribosomal protein L2 (chloroplast) [Veratrum patulum] gi|549531775|gb|AGX28901.1| 50S ribosomal protein L2 (chloroplast) [Veratrum patulum] Length = 274 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 N++ S+ R LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 NQVKSNPRNNLIYGQHRCSKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >gb|AEK71473.1| ribosomal protein L2 [Eucryphia lucida] Length = 274 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCGKGRNARGIITAG-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_665619.1| ribosomal protein L2 [Populus alba] gi|122243403|sp|Q14F95.1|RK2A_POPAL RecName: Full=50S ribosomal protein L2-A, chloroplastic gi|109945579|dbj|BAE97267.1| ribosomal protein L2 [Populus alba] Length = 275 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAR-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_665599.1| ribosomal protein L2 [Populus alba] gi|122230949|sp|Q14FB6.1|RK2B_POPAL RecName: Full=50S ribosomal protein L2-B, chloroplastic gi|109945558|dbj|BAE97246.1| ribosomal protein L2 [Populus alba] Length = 274 Score = 72.4 bits (176), Expect = 6e-11 Identities = 36/51 (70%), Positives = 44/51 (86%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCSKGRNARGIITAR-HRGGGHKRLYRKIDFRRNE 69 >gb|AHA12721.1| ribosomal protein L2 [Orchidantha fimbriata] Length = 131 Score = 72.0 bits (175), Expect = 8e-11 Identities = 39/64 (60%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = -1 Query: 187 QTEKPPLIKRKKN-KLLSHTRRKLIYGYHR-AKGRNARGVMTAWWHRGGGHKRLYRKIDF 14 +T P + R N ++ S+ R LIYG HR +KGRNARG++TA HRGGGHKRLYRKIDF Sbjct: 7 KTSTPSIRNRAVNSQVKSNPRNNLIYGQHRCSKGRNARGIITAR-HRGGGHKRLYRKIDF 65 Query: 13 RRNK 2 RRN+ Sbjct: 66 RRNE 69 >ref|YP_053196.1| ribosomal protein L2 [Nymphaea alba] gi|50346850|ref|YP_053221.1| ribosomal protein L2 [Nymphaea alba] gi|68052951|sp|Q6EVY5.1|RK2_NYMAL RecName: Full=50S ribosomal protein L2, chloroplastic gi|50250370|emb|CAF28636.1| ribosomal protein L2 [Nymphaea alba] gi|50250395|emb|CAF28661.1| ribosomal protein L2 [Nymphaea alba] Length = 273 Score = 72.0 bits (175), Expect = 8e-11 Identities = 40/69 (57%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = -1 Query: 205 FLSEEPQTEKPPLIKRKKNKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLY 29 + + P T K + + K S+ R KLIYG HR KGRNARG++TA HRGGGHKRLY Sbjct: 6 YKTSTPSTRKGAVDSQAK----SNPRTKLIYGQHRCGKGRNARGIITAR-HRGGGHKRLY 60 Query: 28 RKIDFRRNK 2 RKIDFRRN+ Sbjct: 61 RKIDFRRNE 69 >gb|AFG25638.1| ribosomal protein L2, partial [Apostasia wallichii] Length = 273 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/51 (70%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+ R LIYG HR KGRNARG++TA HRGGGHKRLYRKIDFRRNK Sbjct: 19 SQVKSNARNNLIYGQHRCGKGRNARGIITAG-HRGGGHKRLYRKIDFRRNK 68 >gb|AEK71537.1| ribosomal protein L2 [Phyllanthus calycinus] Length = 274 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCGKGRNARGIITAR-HRGGGHKRLYRKIDFRRNE 69 >gb|AEK71530.1| ribosomal protein L2 [Ochna mossambicensis] Length = 274 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCGKGRNARGIITAR-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_002720176.1| rpl2 [Jatropha curcas] gi|224979627|gb|ACN72754.1| rpl2 [Jatropha curcas] Length = 287 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCGKGRNARGIITAR-HRGGGHKRLYRKIDFRRNE 69 >ref|YP_002720153.1| rpl2 [Jatropha curcas] gi|224979605|gb|ACN72732.1| rpl2 [Jatropha curcas] Length = 287 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/51 (70%), Positives = 43/51 (84%), Gaps = 1/51 (1%) Frame = -1 Query: 151 NKLLSHTRRKLIYGYHRA-KGRNARGVMTAWWHRGGGHKRLYRKIDFRRNK 2 +++ S+TR LIYG HR KGRNARG++TA HRGGGHKRLYRKIDFRRN+ Sbjct: 20 SQVKSNTRNNLIYGQHRCGKGRNARGIITAR-HRGGGHKRLYRKIDFRRNE 69