BLASTX nr result
ID: Paeonia23_contig00013917
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00013917 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCL55187.1| conserved hypothetical protein [Clostridium diff... 82 6e-14 ref|NP_013263.1| hypothetical protein YLR162W [Saccharomyces cer... 74 2e-11 >emb|CCL55187.1| conserved hypothetical protein [Clostridium difficile E14] Length = 59 Score = 82.4 bits (202), Expect = 6e-14 Identities = 42/59 (71%), Positives = 44/59 (74%) Frame = +3 Query: 15 MYKSDN*SLISEDRNNKATLLLTILRCTFKSYAKDLSPRIMTLQFVSKHTKPFR*AYHC 191 M KSDN LIS DRNNKATLLLTI RCT KSY DLSPR MTLQ SKH +PFR + C Sbjct: 1 MNKSDNRGLISADRNNKATLLLTIPRCTSKSYTNDLSPRKMTLQSASKHPRPFRQVHRC 59 >ref|NP_013263.1| hypothetical protein YLR162W [Saccharomyces cerevisiae S288c] gi|74644952|sp|Q06235.1|YL162_YEAST RecName: Full=Protein YLR162W gi|1234844|gb|AAB67486.1| Ylr162wp [Saccharomyces cerevisiae] gi|285813587|tpg|DAA09483.1| TPA: hypothetical protein YLR162W [Saccharomyces cerevisiae S288c] Length = 118 Score = 73.9 bits (180), Expect = 2e-11 Identities = 38/57 (66%), Positives = 40/57 (70%) Frame = +3 Query: 21 KSDN*SLISEDRNNKATLLLTILRCTFKSYAKDLSPRIMTLQFVSKHTKPFR*AYHC 191 KSDN LIS DRNNKATLLLTI RCT KSY DLSP MTL KH +PFR + C Sbjct: 62 KSDNKGLISADRNNKATLLLTIPRCTSKSYTNDLSPLKMTLLSAGKHPRPFRQEHRC 118