BLASTX nr result
ID: Paeonia23_contig00013717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00013717 (551 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50966.1| T4.5 [Malus x robusta] 57 3e-06 >emb|CCH50966.1| T4.5 [Malus x robusta] Length = 1670 Score = 57.0 bits (136), Expect = 3e-06 Identities = 33/94 (35%), Positives = 42/94 (44%) Frame = -1 Query: 284 PMSNLGSQSASVSS*LCHMHGHFTPNCPRIQQFVHPFGPGFASFHTCSKPHPYDPTWYPN 105 P S SV LC +GH+ P C R+ QF P S T S Y W + Sbjct: 538 PAGPSSSSGCSVQCQLCLQYGHWAPMCNRLSQFAQSQSPTAMSAMTSSASPSY---WLTD 594 Query: 104 AGASTHMIGDSRPLQTRIPYSGSDSALPGNNDKL 3 +GAS H+ D L + IPYSG+D G+ L Sbjct: 595 SGASHHVTPDPSALNSAIPYSGNDQLFVGDGKGL 628