BLASTX nr result
ID: Paeonia23_contig00013319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00013319 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGE33715.1| hypothetical protein, partial [Populus pruinosa] ... 79 5e-13 gb|AGE33172.1| hypothetical protein, partial [Populus euphratica... 79 5e-13 ref|XP_003552329.1| PREDICTED: uncharacterized protein LOC100815... 79 5e-13 ref|XP_007033462.1| Serine/threonine-protein phosphatase PP-Z [T... 78 1e-12 ref|XP_002531808.1| conserved hypothetical protein [Ricinus comm... 78 1e-12 ref|XP_003534624.1| PREDICTED: uncharacterized protein LOC100798... 77 2e-12 ref|XP_006381262.1| hypothetical protein POPTR_0006s11200g [Popu... 77 2e-12 ref|XP_006429643.1| hypothetical protein CICLE_v10012066mg [Citr... 77 3e-12 ref|XP_007140040.1| hypothetical protein PHAVU_008G079300g [Phas... 76 4e-12 gb|AGV54218.1| hypothetical protein [Phaseolus vulgaris] 76 4e-12 ref|XP_004492377.1| PREDICTED: uncharacterized protein LOC101488... 76 6e-12 gb|EYU26425.1| hypothetical protein MIMGU_mgv1a008742mg [Mimulus... 75 7e-12 gb|EXB75313.1| hypothetical protein L484_008766 [Morus notabilis] 75 7e-12 ref|XP_004492403.1| PREDICTED: uncharacterized protein LOC101500... 75 9e-12 ref|XP_004142670.1| PREDICTED: uncharacterized protein LOC101209... 74 2e-11 ref|XP_004302514.1| PREDICTED: uncharacterized protein LOC101298... 74 3e-11 ref|XP_002323685.2| hypothetical protein POPTR_0016s14750g [Popu... 73 4e-11 ref|XP_006359982.1| PREDICTED: uncharacterized protein LOC102590... 73 5e-11 ref|XP_007205403.1| hypothetical protein PRUPE_ppa007556mg [Prun... 72 8e-11 ref|XP_003623651.1| hypothetical protein MTR_7g074070 [Medicago ... 72 1e-10 >gb|AGE33715.1| hypothetical protein, partial [Populus pruinosa] gi|447390508|gb|AGE33717.1| hypothetical protein, partial [Populus pruinosa] gi|447390512|gb|AGE33719.1| hypothetical protein, partial [Populus pruinosa] gi|447390516|gb|AGE33721.1| hypothetical protein, partial [Populus pruinosa] gi|447390520|gb|AGE33723.1| hypothetical protein, partial [Populus pruinosa] Length = 194 Score = 79.3 bits (194), Expect = 5e-13 Identities = 41/70 (58%), Positives = 49/70 (70%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L +F N SHMFEPG + FMN +G FVYKG IF VGF GLV T++S GLI +R KK Sbjct: 75 LPAIFANCPTSHMFEPGAYGFMNRLGTFVYKGTIFAAVGFAAGLVGTALSNGLIKMR-KK 133 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 134 MDPTFETPNK 143 >gb|AGE33172.1| hypothetical protein, partial [Populus euphratica] gi|447388947|gb|AGE33173.1| hypothetical protein, partial [Populus euphratica] gi|447388949|gb|AGE33174.1| hypothetical protein, partial [Populus euphratica] gi|447388951|gb|AGE33175.1| hypothetical protein, partial [Populus euphratica] gi|447388953|gb|AGE33176.1| hypothetical protein, partial [Populus euphratica] gi|447388955|gb|AGE33177.1| hypothetical protein, partial [Populus euphratica] gi|447388957|gb|AGE33178.1| hypothetical protein, partial [Populus euphratica] gi|447388959|gb|AGE33179.1| hypothetical protein, partial [Populus euphratica] gi|447388961|gb|AGE33180.1| hypothetical protein, partial [Populus euphratica] gi|447388963|gb|AGE33181.1| hypothetical protein, partial [Populus euphratica] gi|447388965|gb|AGE33182.1| hypothetical protein, partial [Populus euphratica] gi|447388967|gb|AGE33183.1| hypothetical protein, partial [Populus euphratica] gi|447388969|gb|AGE33184.1| hypothetical protein, partial [Populus euphratica] gi|447388971|gb|AGE33185.1| hypothetical protein, partial [Populus euphratica] gi|447388973|gb|AGE33186.1| hypothetical protein, partial [Populus euphratica] gi|447388975|gb|AGE33187.1| hypothetical protein, partial [Populus euphratica] gi|447388977|gb|AGE33188.1| hypothetical protein, partial [Populus euphratica] gi|447388979|gb|AGE33189.1| hypothetical protein, partial [Populus euphratica] gi|447388981|gb|AGE33190.1| hypothetical protein, partial [Populus euphratica] gi|447388983|gb|AGE33191.1| hypothetical protein, partial [Populus euphratica] gi|447388985|gb|AGE33192.1| hypothetical protein, partial [Populus euphratica] gi|447388987|gb|AGE33193.1| hypothetical protein, partial [Populus euphratica] gi|447388989|gb|AGE33194.1| hypothetical protein, partial [Populus euphratica] gi|447388991|gb|AGE33195.1| hypothetical protein, partial [Populus euphratica] gi|447388993|gb|AGE33196.1| hypothetical protein, partial [Populus euphratica] gi|447388995|gb|AGE33197.1| hypothetical protein, partial [Populus euphratica] gi|447388997|gb|AGE33198.1| hypothetical protein, partial [Populus euphratica] gi|447388999|gb|AGE33199.1| hypothetical protein, partial [Populus euphratica] gi|447389001|gb|AGE33200.1| hypothetical protein, partial [Populus euphratica] gi|447389003|gb|AGE33201.1| hypothetical protein, partial [Populus euphratica] gi|447389005|gb|AGE33202.1| hypothetical protein, partial [Populus euphratica] gi|447389007|gb|AGE33203.1| hypothetical protein, partial [Populus euphratica] gi|447389009|gb|AGE33204.1| hypothetical protein, partial [Populus euphratica] gi|447389011|gb|AGE33205.1| hypothetical protein, partial [Populus euphratica] gi|447389013|gb|AGE33206.1| hypothetical protein, partial [Populus euphratica] gi|447389015|gb|AGE33207.1| hypothetical protein, partial [Populus euphratica] gi|447389017|gb|AGE33208.1| hypothetical protein, partial [Populus euphratica] gi|447389019|gb|AGE33209.1| hypothetical protein, partial [Populus euphratica] gi|447389021|gb|AGE33210.1| hypothetical protein, partial [Populus euphratica] gi|447389023|gb|AGE33211.1| hypothetical protein, partial [Populus euphratica] gi|447389025|gb|AGE33212.1| hypothetical protein, partial [Populus euphratica] gi|447389027|gb|AGE33213.1| hypothetical protein, partial [Populus euphratica] gi|447389029|gb|AGE33214.1| hypothetical protein, partial [Populus euphratica] gi|447389031|gb|AGE33215.1| hypothetical protein, partial [Populus euphratica] gi|447389033|gb|AGE33216.1| hypothetical protein, partial [Populus euphratica] gi|447389035|gb|AGE33217.1| hypothetical protein, partial [Populus euphratica] gi|447390494|gb|AGE33710.1| hypothetical protein, partial [Populus pruinosa] gi|447390496|gb|AGE33711.1| hypothetical protein, partial [Populus pruinosa] gi|447390498|gb|AGE33712.1| hypothetical protein, partial [Populus pruinosa] gi|447390500|gb|AGE33713.1| hypothetical protein, partial [Populus pruinosa] gi|447390502|gb|AGE33714.1| hypothetical protein, partial [Populus pruinosa] gi|447390506|gb|AGE33716.1| hypothetical protein, partial [Populus pruinosa] gi|447390510|gb|AGE33718.1| hypothetical protein, partial [Populus pruinosa] gi|447390514|gb|AGE33720.1| hypothetical protein, partial [Populus pruinosa] gi|447390518|gb|AGE33722.1| hypothetical protein, partial [Populus pruinosa] gi|447390522|gb|AGE33724.1| hypothetical protein, partial [Populus pruinosa] gi|447390524|gb|AGE33725.1| hypothetical protein, partial [Populus pruinosa] gi|447390526|gb|AGE33726.1| hypothetical protein, partial [Populus pruinosa] gi|447390528|gb|AGE33727.1| hypothetical protein, partial [Populus pruinosa] gi|447390530|gb|AGE33728.1| hypothetical protein, partial [Populus pruinosa] gi|447390532|gb|AGE33729.1| hypothetical protein, partial [Populus pruinosa] gi|447390534|gb|AGE33730.1| hypothetical protein, partial [Populus pruinosa] gi|447390536|gb|AGE33731.1| hypothetical protein, partial [Populus pruinosa] gi|447390538|gb|AGE33732.1| hypothetical protein, partial [Populus pruinosa] gi|447390540|gb|AGE33733.1| hypothetical protein, partial [Populus pruinosa] gi|447390542|gb|AGE33734.1| hypothetical protein, partial [Populus pruinosa] gi|447390544|gb|AGE33735.1| hypothetical protein, partial [Populus pruinosa] gi|447390546|gb|AGE33736.1| hypothetical protein, partial [Populus pruinosa] gi|447390548|gb|AGE33737.1| hypothetical protein, partial [Populus pruinosa] gi|447390550|gb|AGE33738.1| hypothetical protein, partial [Populus pruinosa] gi|447390552|gb|AGE33739.1| hypothetical protein, partial [Populus pruinosa] gi|447390554|gb|AGE33740.1| hypothetical protein, partial [Populus pruinosa] gi|447390556|gb|AGE33741.1| hypothetical protein, partial [Populus pruinosa] gi|447390558|gb|AGE33742.1| hypothetical protein, partial [Populus pruinosa] gi|447390560|gb|AGE33743.1| hypothetical protein, partial [Populus pruinosa] gi|447390562|gb|AGE33744.1| hypothetical protein, partial [Populus pruinosa] gi|447390564|gb|AGE33745.1| hypothetical protein, partial [Populus pruinosa] gi|447390566|gb|AGE33746.1| hypothetical protein, partial [Populus pruinosa] gi|447390568|gb|AGE33747.1| hypothetical protein, partial [Populus pruinosa] Length = 194 Score = 79.3 bits (194), Expect = 5e-13 Identities = 41/70 (58%), Positives = 49/70 (70%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L +F N SHMFEPG + FMN +G FVYKG IF VGF GLV T++S GLI +R KK Sbjct: 75 LPAIFANCPTSHMFEPGAYGFMNRLGTFVYKGTIFAAVGFAAGLVGTALSNGLIKMR-KK 133 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 134 MDPTFETPNK 143 >ref|XP_003552329.1| PREDICTED: uncharacterized protein LOC100815884 [Glycine max] Length = 347 Score = 79.3 bits (194), Expect = 5e-13 Identities = 43/77 (55%), Positives = 53/77 (68%) Frame = +2 Query: 29 TDSFVFNLHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGL 208 T S NL LF + KSHMFEPG F+ ++ +G VYKG IF VVGF GLV T++S GL Sbjct: 162 TSSAASNLPALFASCPKSHMFEPGAFSLLDRLGTLVYKGTIFSVVGFGAGLVGTTLSNGL 221 Query: 209 IAVRKKKMNLEFETPNR 259 I +R KKM+ FETPN+ Sbjct: 222 IKMR-KKMDPTFETPNK 237 >ref|XP_007033462.1| Serine/threonine-protein phosphatase PP-Z [Theobroma cacao] gi|508712491|gb|EOY04388.1| Serine/threonine-protein phosphatase PP-Z [Theobroma cacao] Length = 357 Score = 78.2 bits (191), Expect = 1e-12 Identities = 40/71 (56%), Positives = 51/71 (71%) Frame = +2 Query: 47 NLHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKK 226 +L +F N +SHMFE G +TFMN +G FV+KG +F VGF GLV T+IS GLI +R K Sbjct: 182 SLPAIFANCPQSHMFELGAYTFMNRLGTFVFKGTVFAAVGFAAGLVGTAISNGLINMR-K 240 Query: 227 KMNLEFETPNR 259 KM+ FETPN+ Sbjct: 241 KMDPSFETPNK 251 >ref|XP_002531808.1| conserved hypothetical protein [Ricinus communis] gi|223528542|gb|EEF30565.1| conserved hypothetical protein [Ricinus communis] Length = 680 Score = 78.2 bits (191), Expect = 1e-12 Identities = 41/70 (58%), Positives = 48/70 (68%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L +F N SHMFEPG FT MN +G VYKG IF VGF GLV T++S GLI +R KK Sbjct: 511 LPAIFANCPASHMFEPGAFTLMNRLGTAVYKGTIFAAVGFAAGLVGTALSNGLITMR-KK 569 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 570 MDPTFETPNK 579 >ref|XP_003534624.1| PREDICTED: uncharacterized protein LOC100798978 [Glycine max] Length = 349 Score = 77.4 bits (189), Expect = 2e-12 Identities = 41/71 (57%), Positives = 51/71 (71%) Frame = +2 Query: 47 NLHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKK 226 NL LF + KSHMFEPG F+ ++ +G VYKG IF VVGF GLV T++S GLI +R K Sbjct: 172 NLPALFASCPKSHMFEPGAFSLLDRLGTLVYKGTIFSVVGFGAGLVGTTLSNGLIKMR-K 230 Query: 227 KMNLEFETPNR 259 KM+ FETPN+ Sbjct: 231 KMDPTFETPNK 241 >ref|XP_006381262.1| hypothetical protein POPTR_0006s11200g [Populus trichocarpa] gi|566175661|ref|XP_006381263.1| hypothetical protein POPTR_0006s11200g [Populus trichocarpa] gi|118483602|gb|ABK93697.1| unknown [Populus trichocarpa] gi|118486849|gb|ABK95259.1| unknown [Populus trichocarpa] gi|550335963|gb|ERP59059.1| hypothetical protein POPTR_0006s11200g [Populus trichocarpa] gi|550335964|gb|ERP59060.1| hypothetical protein POPTR_0006s11200g [Populus trichocarpa] Length = 357 Score = 77.0 bits (188), Expect = 2e-12 Identities = 40/70 (57%), Positives = 48/70 (68%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L +F N SHMFEPG + MN +G FVYKG IF VGF GLV T++S GLI +R KK Sbjct: 181 LPAIFANCPTSHMFEPGAYGLMNRLGTFVYKGTIFAAVGFAAGLVGTALSNGLIKMR-KK 239 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 240 MDPTFETPNK 249 >ref|XP_006429643.1| hypothetical protein CICLE_v10012066mg [Citrus clementina] gi|568855306|ref|XP_006481248.1| PREDICTED: uncharacterized protein LOC102616987 [Citrus sinensis] gi|557531700|gb|ESR42883.1| hypothetical protein CICLE_v10012066mg [Citrus clementina] Length = 354 Score = 76.6 bits (187), Expect = 3e-12 Identities = 41/71 (57%), Positives = 50/71 (70%) Frame = +2 Query: 47 NLHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKK 226 NL LF + SHMFEPG F+F N +G FV+KG +F VGF GLV T+IS GLI +R K Sbjct: 185 NLPGLFASCPTSHMFEPGAFSFANRLGTFVFKGLVFASVGFAAGLVGTAISNGLIKLR-K 243 Query: 227 KMNLEFETPNR 259 KM+ FETPN+ Sbjct: 244 KMDPAFETPNK 254 >ref|XP_007140040.1| hypothetical protein PHAVU_008G079300g [Phaseolus vulgaris] gi|561013173|gb|ESW12034.1| hypothetical protein PHAVU_008G079300g [Phaseolus vulgaris] Length = 341 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = +2 Query: 59 LFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKKMNL 238 LF + KSHMFEPG +T ++ +G VYKG IF VVGF GLV T++S GLI +R KKM+ Sbjct: 169 LFASCPKSHMFEPGAYTLLHRLGTLVYKGTIFAVVGFGAGLVGTTLSNGLIKIR-KKMDP 227 Query: 239 EFETPNR 259 FETPN+ Sbjct: 228 TFETPNK 234 >gb|AGV54218.1| hypothetical protein [Phaseolus vulgaris] Length = 341 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/67 (58%), Positives = 49/67 (73%) Frame = +2 Query: 59 LFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKKMNL 238 LF + KSHMFEPG +T ++ +G VYKG IF VVGF GLV T++S GLI +R KKM+ Sbjct: 169 LFASCPKSHMFEPGAYTLLHRLGTLVYKGTIFAVVGFGAGLVGTTLSNGLIKIR-KKMDP 227 Query: 239 EFETPNR 259 FETPN+ Sbjct: 228 TFETPNK 234 >ref|XP_004492377.1| PREDICTED: uncharacterized protein LOC101488595 [Cicer arietinum] Length = 344 Score = 75.9 bits (185), Expect = 6e-12 Identities = 38/67 (56%), Positives = 48/67 (71%) Frame = +2 Query: 59 LFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKKMNL 238 +F + KSHMFEPG F+ +N +G VYKG IF VGF GLV T++S GLI +R KKM+ Sbjct: 175 IFASCPKSHMFEPGAFSLLNRLGTLVYKGTIFAAVGFGAGLVGTAVSNGLITMR-KKMDP 233 Query: 239 EFETPNR 259 FETPN+ Sbjct: 234 NFETPNK 240 >gb|EYU26425.1| hypothetical protein MIMGU_mgv1a008742mg [Mimulus guttatus] Length = 364 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/70 (54%), Positives = 49/70 (70%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L ++F N SHMF+PG +T + VG FVYKG +F VGF GLV T++S GLI +R KK Sbjct: 190 LPSIFANSPTSHMFQPGPYTLLGRVGTFVYKGAVFAAVGFAAGLVGTALSNGLIKMR-KK 248 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 249 MDPNFETPNK 258 >gb|EXB75313.1| hypothetical protein L484_008766 [Morus notabilis] Length = 359 Score = 75.5 bits (184), Expect = 7e-12 Identities = 40/71 (56%), Positives = 47/71 (66%) Frame = +2 Query: 47 NLHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKK 226 NL +F N KSHMFE G FT +G +YKG +F VG G V T+IS GLIAVR K Sbjct: 182 NLPAIFANCPKSHMFEAGSFTLGQRLGTLLYKGTVFAAVGLAAGFVGTAISNGLIAVR-K 240 Query: 227 KMNLEFETPNR 259 KM+ EFETPN+ Sbjct: 241 KMDPEFETPNK 251 >ref|XP_004492403.1| PREDICTED: uncharacterized protein LOC101500186 [Cicer arietinum] Length = 347 Score = 75.1 bits (183), Expect = 9e-12 Identities = 38/67 (56%), Positives = 48/67 (71%) Frame = +2 Query: 59 LFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKKMNL 238 +F + KSHMFEPG F+ +N +G VYKG IF VGF GLV T++S GLI + KKKM+ Sbjct: 176 IFASCPKSHMFEPGVFSLLNRLGTLVYKGAIFSAVGFGAGLVGTAVSNGLITM-KKKMDP 234 Query: 239 EFETPNR 259 FETPN+ Sbjct: 235 NFETPNK 241 >ref|XP_004142670.1| PREDICTED: uncharacterized protein LOC101209534 isoform 1 [Cucumis sativus] gi|449449837|ref|XP_004142671.1| PREDICTED: uncharacterized protein LOC101209534 isoform 2 [Cucumis sativus] gi|449510965|ref|XP_004163824.1| PREDICTED: uncharacterized protein LOC101229310 isoform 1 [Cucumis sativus] gi|449510969|ref|XP_004163825.1| PREDICTED: uncharacterized protein LOC101229310 isoform 2 [Cucumis sativus] Length = 370 Score = 74.3 bits (181), Expect = 2e-11 Identities = 38/70 (54%), Positives = 49/70 (70%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L ++F + SHMFEPG FT ++ VG FVYKG +F VG GLV T++S GLI +R KK Sbjct: 193 LPSIFASCPTSHMFEPGAFTLLDRVGTFVYKGTVFAAVGLAAGLVGTALSNGLIMLR-KK 251 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 252 MDPGFETPNK 261 >ref|XP_004302514.1| PREDICTED: uncharacterized protein LOC101298524 [Fragaria vesca subsp. vesca] Length = 358 Score = 73.6 bits (179), Expect = 3e-11 Identities = 38/70 (54%), Positives = 49/70 (70%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L ++F + SHMFEPG F M+ +G FVYKG +F VGF GL T++S GLI +R KK Sbjct: 187 LPSIFASCPASHMFEPGSFGLMSRLGTFVYKGAVFAGVGFAAGLAGTALSNGLIKLR-KK 245 Query: 230 MNLEFETPNR 259 M+ EFETPN+ Sbjct: 246 MDPEFETPNK 255 >ref|XP_002323685.2| hypothetical protein POPTR_0016s14750g [Populus trichocarpa] gi|550321529|gb|EEF05446.2| hypothetical protein POPTR_0016s14750g [Populus trichocarpa] Length = 352 Score = 73.2 bits (178), Expect = 4e-11 Identities = 38/70 (54%), Positives = 47/70 (67%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L +F N SHMFEPG ++ M+ +G VYKG IF VGF GLV T +S GLI +R KK Sbjct: 176 LPAIFANCPTSHMFEPGAYSLMSRLGTLVYKGIIFAAVGFAAGLVGTELSNGLIKMR-KK 234 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 235 MDPSFETPNK 244 >ref|XP_006359982.1| PREDICTED: uncharacterized protein LOC102590049 isoform X1 [Solanum tuberosum] gi|565388435|ref|XP_006359983.1| PREDICTED: uncharacterized protein LOC102590049 isoform X2 [Solanum tuberosum] Length = 355 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/70 (52%), Positives = 48/70 (68%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L ++F + SHMFEPG ++ + VG VYKG +F VGF GLV T+IS GLI +R KK Sbjct: 179 LPSIFASCPPSHMFEPGAYSLFSRVGTLVYKGTLFAAVGFAAGLVGTAISNGLIKIR-KK 237 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 238 MDPNFETPNK 247 >ref|XP_007205403.1| hypothetical protein PRUPE_ppa007556mg [Prunus persica] gi|462401045|gb|EMJ06602.1| hypothetical protein PRUPE_ppa007556mg [Prunus persica] Length = 364 Score = 72.0 bits (175), Expect = 8e-11 Identities = 36/70 (51%), Positives = 48/70 (68%) Frame = +2 Query: 50 LHTLFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKK 229 L ++F + SHMFEPG + +N +G FVYKG +F VGF GL T++S GLI +R KK Sbjct: 187 LPSIFASCPASHMFEPGSYGLVNRLGTFVYKGAVFAAVGFAAGLAGTALSNGLIKLR-KK 245 Query: 230 MNLEFETPNR 259 M+ FETPN+ Sbjct: 246 MDPNFETPNK 255 >ref|XP_003623651.1| hypothetical protein MTR_7g074070 [Medicago truncatula] gi|355498666|gb|AES79869.1| hypothetical protein MTR_7g074070 [Medicago truncatula] Length = 353 Score = 71.6 bits (174), Expect = 1e-10 Identities = 36/67 (53%), Positives = 47/67 (70%) Frame = +2 Query: 59 LFVNFFKSHMFEPGFFTFMN*VGIFVYKGDIFVVVGFTIGLVRTSISKGLIAVRKKKMNL 238 +F + KSHMFEPG F+ ++ +G VYKG IF VGF GL T++S GLI +R KKM+ Sbjct: 182 IFASCPKSHMFEPGAFSLLDRLGTLVYKGTIFAAVGFGAGLAGTALSNGLIKMR-KKMDP 240 Query: 239 EFETPNR 259 FETPN+ Sbjct: 241 NFETPNK 247