BLASTX nr result
ID: Paeonia23_contig00012356
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00012356 (311 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006443875.1| hypothetical protein CICLE_v10021217mg [Citr... 60 2e-07 ref|XP_006443874.1| hypothetical protein CICLE_v10021217mg [Citr... 60 2e-07 ref|XP_006443873.1| hypothetical protein CICLE_v10021217mg [Citr... 60 2e-07 ref|XP_007201819.1| hypothetical protein PRUPE_ppa008841mg [Prun... 56 6e-06 ref|XP_002446380.1| hypothetical protein SORBIDRAFT_06g014980 [S... 56 6e-06 ref|XP_002454797.1| hypothetical protein SORBIDRAFT_04g037570 [S... 56 6e-06 ref|XP_004289917.1| PREDICTED: deoxyhypusine hydroxylase-like [F... 55 8e-06 >ref|XP_006443875.1| hypothetical protein CICLE_v10021217mg [Citrus clementina] gi|568851777|ref|XP_006479563.1| PREDICTED: deoxyhypusine hydroxylase-like [Citrus sinensis] gi|557546137|gb|ESR57115.1| hypothetical protein CICLE_v10021217mg [Citrus clementina] Length = 318 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 200 SRAFKSSPEMEEFLCSQLLDPIQPISNRIRALFSIRN 310 + AFKSSPEME+FLC +L+DP QPIS R RALFS+RN Sbjct: 8 TNAFKSSPEMEKFLCDRLVDPTQPISERFRALFSLRN 44 >ref|XP_006443874.1| hypothetical protein CICLE_v10021217mg [Citrus clementina] gi|557546136|gb|ESR57114.1| hypothetical protein CICLE_v10021217mg [Citrus clementina] Length = 270 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 200 SRAFKSSPEMEEFLCSQLLDPIQPISNRIRALFSIRN 310 + AFKSSPEME+FLC +L+DP QPIS R RALFS+RN Sbjct: 8 TNAFKSSPEMEKFLCDRLVDPTQPISERFRALFSLRN 44 >ref|XP_006443873.1| hypothetical protein CICLE_v10021217mg [Citrus clementina] gi|557546135|gb|ESR57113.1| hypothetical protein CICLE_v10021217mg [Citrus clementina] Length = 194 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 200 SRAFKSSPEMEEFLCSQLLDPIQPISNRIRALFSIRN 310 + AFKSSPEME+FLC +L+DP QPIS R RALFS+RN Sbjct: 8 TNAFKSSPEMEKFLCDRLVDPTQPISERFRALFSLRN 44 >ref|XP_007201819.1| hypothetical protein PRUPE_ppa008841mg [Prunus persica] gi|462397219|gb|EMJ03018.1| hypothetical protein PRUPE_ppa008841mg [Prunus persica] Length = 317 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +2 Query: 206 AFKSSPEMEEFLCSQLLDPIQPISNRIRALFSIRN 310 +F+SSPEM +FLC +LLDP QPIS R RALFS+RN Sbjct: 12 SFESSPEMVKFLCDRLLDPTQPISERFRALFSLRN 46 >ref|XP_002446380.1| hypothetical protein SORBIDRAFT_06g014980 [Sorghum bicolor] gi|241937563|gb|EES10708.1| hypothetical protein SORBIDRAFT_06g014980 [Sorghum bicolor] Length = 94 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 197 ASRAFKSSPEMEEFLCSQLLDPIQPISNRIRALFSIRN 310 A+ AF+SSPEME FLC +LLD QPI+ R RALFS+RN Sbjct: 3 ATSAFESSPEMERFLCKRLLDAEQPIAERFRALFSLRN 40 >ref|XP_002454797.1| hypothetical protein SORBIDRAFT_04g037570 [Sorghum bicolor] gi|241934628|gb|EES07773.1| hypothetical protein SORBIDRAFT_04g037570 [Sorghum bicolor] Length = 312 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +2 Query: 197 ASRAFKSSPEMEEFLCSQLLDPIQPISNRIRALFSIRN 310 A+ AF+SSPEME FLC +LLD QPI+ R RALFS+RN Sbjct: 3 ATSAFESSPEMERFLCERLLDAEQPIAERFRALFSLRN 40 >ref|XP_004289917.1| PREDICTED: deoxyhypusine hydroxylase-like [Fragaria vesca subsp. vesca] Length = 319 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +2 Query: 209 FKSSPEMEEFLCSQLLDPIQPISNRIRALFSIRN 310 F+SSPEM +FLC +LLDP QPIS R RALFS+RN Sbjct: 15 FESSPEMVKFLCERLLDPAQPISERFRALFSLRN 48