BLASTX nr result
ID: Paeonia23_contig00012353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00012353 (274 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007151865.1| hypothetical protein PHAVU_004G082100g [Phas... 59 4e-10 ref|XP_004164520.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-int... 58 5e-10 ref|XP_004151854.1| PREDICTED: tuftelin-interacting protein 11-l... 58 5e-10 ref|XP_003548069.1| PREDICTED: tuftelin-interacting protein 11-l... 56 9e-10 ref|XP_002265002.1| PREDICTED: tuftelin-interacting protein 11-l... 56 9e-10 gb|EXB56432.1| Tuftelin-interacting protein 11 [Morus notabilis] 55 3e-08 ref|XP_004510195.1| PREDICTED: tuftelin-interacting protein 11-l... 50 3e-08 emb|CBI26422.3| unnamed protein product [Vitis vinifera] 56 6e-08 ref|XP_007225316.1| hypothetical protein PRUPE_ppa001171mg [Prun... 54 2e-07 ref|XP_007211094.1| hypothetical protein PRUPE_ppa001175mg [Prun... 52 3e-07 ref|XP_006836389.1| hypothetical protein AMTR_s00092p00133670 [A... 60 3e-07 gb|EYU19756.1| hypothetical protein MIMGU_mgv1a001252mg [Mimulus... 55 1e-06 ref|XP_003623392.1| Tuftelin-interacting-like protein [Medicago ... 47 6e-06 ref|XP_006352537.1| PREDICTED: tuftelin-interacting protein 11-l... 55 8e-06 ref|XP_004248294.1| PREDICTED: tuftelin-interacting protein 11-l... 55 8e-06 ref|XP_004300043.1| PREDICTED: tuftelin-interacting protein 11-l... 48 8e-06 >ref|XP_007151865.1| hypothetical protein PHAVU_004G082100g [Phaseolus vulgaris] gi|561025174|gb|ESW23859.1| hypothetical protein PHAVU_004G082100g [Phaseolus vulgaris] Length = 871 Score = 58.5 bits (140), Expect(2) = 4e-10 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 ++E FFFSKW QVLY+WLCSNP FE V +WYL Sbjct: 679 MMEKFFFSKWLQVLYHWLCSNPNFEEVTKWYL 710 Score = 31.2 bits (69), Expect(2) = 4e-10 Identities = 18/34 (52%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = -1 Query: 94 LLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 LLA+ I + LN GL +MNQA+ EV+Q GL+E Sbjct: 720 LLANESIRYQLNRGLDMMNQAVEGMEVVQPGLKE 753 >ref|XP_004164520.1| PREDICTED: LOW QUALITY PROTEIN: tuftelin-interacting protein 11-like [Cucumis sativus] Length = 872 Score = 57.8 bits (138), Expect(2) = 5e-10 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 ++E FFFSKW QVLY+WLCSNP FE V +WY+ Sbjct: 677 MMEKFFFSKWLQVLYHWLCSNPNFEEVTKWYM 708 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -1 Query: 121 WPVVFELKGLLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 W +F K LLA+ I + L+ GL +MNQA+ EV+Q GL+E Sbjct: 710 WKELFP-KELLANESIRYQLSCGLDMMNQAVEGMEVVQPGLKE 751 >ref|XP_004151854.1| PREDICTED: tuftelin-interacting protein 11-like [Cucumis sativus] Length = 871 Score = 57.8 bits (138), Expect(2) = 5e-10 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 ++E FFFSKW QVLY+WLCSNP FE V +WY+ Sbjct: 676 MMEKFFFSKWLQVLYHWLCSNPNFEEVTKWYM 707 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%) Frame = -1 Query: 121 WPVVFELKGLLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 W +F K LLA+ I + L+ GL +MNQA+ EV+Q GL+E Sbjct: 709 WKELFP-KELLANESIRYQLSCGLDMMNQAVEGMEVVQPGLKE 750 >ref|XP_003548069.1| PREDICTED: tuftelin-interacting protein 11-like isoform X1 [Glycine max] gi|571528691|ref|XP_006599440.1| PREDICTED: tuftelin-interacting protein 11-like isoform X2 [Glycine max] Length = 862 Score = 56.2 bits (134), Expect(2) = 9e-10 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 +++ FFF+KW QVLY+WLCSNP FE V +WYL Sbjct: 670 MMDKFFFAKWLQVLYHWLCSNPNFEEVTKWYL 701 Score = 32.3 bits (72), Expect(2) = 9e-10 Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = -1 Query: 100 KGLLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 K LLA+ I + LN GL +MNQA+ EV+Q GL+E Sbjct: 709 KELLANESIRYQLNRGLDMMNQAVEGMEVVQPGLKE 744 >ref|XP_002265002.1| PREDICTED: tuftelin-interacting protein 11-like [Vitis vinifera] Length = 852 Score = 55.8 bits (133), Expect(2) = 9e-10 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 207 VLLLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 V LLE FF KW+QVLY+WLCS P FE V QWYL Sbjct: 657 VELLELHFFPKWQQVLYHWLCSGPNFEEVTQWYL 690 Score = 32.7 bits (73), Expect(2) = 9e-10 Identities = 19/34 (55%), Positives = 24/34 (70%), Gaps = 3/34 (8%) Frame = -1 Query: 94 LLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 LLA+ I + LN GL +MNQA+ EV+Q GLRE Sbjct: 700 LLANEQIRYQLNIGLDMMNQAVEGMEVVQPGLRE 733 >gb|EXB56432.1| Tuftelin-interacting protein 11 [Morus notabilis] Length = 940 Score = 55.5 bits (132), Expect(2) = 3e-08 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWYLN*RD 94 ++E FFF KW QVLY+WLC+NP FE V +W+L +D Sbjct: 755 MMEKFFFPKWLQVLYHWLCANPNFEEVTKWFLGWKD 790 Score = 28.1 bits (61), Expect(2) = 3e-08 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -1 Query: 100 KGLLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 K LLA+ I LN GL +MN+A+ EV+Q GL+E Sbjct: 794 KELLANENIRNQLNCGLDMMNRAVEGMEVVQPGLKE 829 >ref|XP_004510195.1| PREDICTED: tuftelin-interacting protein 11-like [Cicer arietinum] Length = 877 Score = 50.1 bits (118), Expect(2) = 3e-08 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 192 DFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 + FFSKW VLY WLCSNP FE V +WYL Sbjct: 688 EIFFSKWLTVLYRWLCSNPNFEEVTKWYL 716 Score = 33.1 bits (74), Expect(2) = 3e-08 Identities = 19/36 (52%), Positives = 25/36 (69%), Gaps = 3/36 (8%) Frame = -1 Query: 100 KGLLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 K LLA+ I + LN GL +MNQA+ EV+Q GL+E Sbjct: 724 KDLLANESIRYQLNCGLDMMNQAVEGMEVVQPGLKE 759 >emb|CBI26422.3| unnamed protein product [Vitis vinifera] Length = 739 Score = 55.8 bits (133), Expect(2) = 6e-08 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = -2 Query: 207 VLLLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 V LLE FF KW+QVLY+WLCS P FE V QWYL Sbjct: 565 VELLELHFFPKWQQVLYHWLCSGPNFEEVTQWYL 598 Score = 26.6 bits (57), Expect(2) = 6e-08 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = -1 Query: 94 LLASVCIWFDLNFGLLIMNQAIE 26 LLA+ I + LN GL +MNQA+E Sbjct: 608 LLANEQIRYQLNIGLDMMNQAVE 630 >ref|XP_007225316.1| hypothetical protein PRUPE_ppa001171mg [Prunus persica] gi|462422252|gb|EMJ26515.1| hypothetical protein PRUPE_ppa001171mg [Prunus persica] Length = 889 Score = 53.5 bits (127), Expect(2) = 2e-07 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWY 109 +++ FFF+KW QVLY+WLCSNP FE V WY Sbjct: 701 MMDKFFFTKWLQVLYHWLCSNPNFEEVLNWY 731 Score = 27.3 bits (59), Expect(2) = 2e-07 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = -1 Query: 94 LLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 L A+ I + LN GL +MN+A+ EV+Q GL+E Sbjct: 742 LHANESIRYQLNCGLDMMNRAVEGMEVVQPGLKE 775 >ref|XP_007211094.1| hypothetical protein PRUPE_ppa001175mg [Prunus persica] gi|462406829|gb|EMJ12293.1| hypothetical protein PRUPE_ppa001175mg [Prunus persica] Length = 888 Score = 52.4 bits (124), Expect(2) = 3e-07 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWY 109 ++E FFF+KW QVLY+WLCS P FE V WY Sbjct: 700 MMEKFFFTKWLQVLYHWLCSKPNFEEVLNWY 730 Score = 27.7 bits (60), Expect(2) = 3e-07 Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = -1 Query: 94 LLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 L A+ I + LN GL +MN+A+ EVIQ GL+E Sbjct: 741 LHANESIRYQLNCGLDMMNRAVEGMEVIQPGLKE 774 >ref|XP_006836389.1| hypothetical protein AMTR_s00092p00133670 [Amborella trichopoda] gi|548838907|gb|ERM99242.1| hypothetical protein AMTR_s00092p00133670 [Amborella trichopoda] Length = 877 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 207 VLLLEDFFFSKWEQVLYYWLCSNPYFENVGQWYLN*RD 94 V LLE FF+KW+QVLY+WLCSNP FE V QWYL +D Sbjct: 685 VNLLEVGFFTKWQQVLYHWLCSNPNFEEVTQWYLGWKD 722 >gb|EYU19756.1| hypothetical protein MIMGU_mgv1a001252mg [Mimulus guttatus] Length = 853 Score = 54.7 bits (130), Expect(2) = 1e-06 Identities = 21/34 (61%), Positives = 27/34 (79%) Frame = -2 Query: 207 VLLLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 +L L D FF+KW++VLY+WLCS P FE V +WYL Sbjct: 659 MLQLMDIFFNKWQEVLYHWLCSKPNFEEVTKWYL 692 Score = 23.5 bits (49), Expect(2) = 1e-06 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 3/34 (8%) Frame = -1 Query: 94 LLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 L A+ I LN GL +MNQA+ EV GL+E Sbjct: 702 LQANEHIRLRLNLGLDMMNQAVEGMEVAPPGLKE 735 >ref|XP_003623392.1| Tuftelin-interacting-like protein [Medicago truncatula] gi|355498407|gb|AES79610.1| Tuftelin-interacting-like protein [Medicago truncatula] Length = 617 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 186 FFSKWEQVLYYWLCSNPYFENVGQWYLN 103 FF+KW VLY+WLCSNP F V +WYL+ Sbjct: 430 FFTKWLTVLYHWLCSNPNFGEVRKWYLD 457 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -1 Query: 100 KGLLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 K LLA+ I + L+ GL +MNQA+ EV+Q L+E Sbjct: 464 KELLANESIRYKLHCGLCMMNQAVECMEVVQPCLKE 499 >ref|XP_006352537.1| PREDICTED: tuftelin-interacting protein 11-like [Solanum tuberosum] Length = 868 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 207 VLLLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 +L + D FF+KW++VLY+WLCSNP FE V +WYL Sbjct: 674 MLPILDIFFNKWQEVLYHWLCSNPNFEEVTKWYL 707 >ref|XP_004248294.1| PREDICTED: tuftelin-interacting protein 11-like isoform 1 [Solanum lycopersicum] gi|460405663|ref|XP_004248295.1| PREDICTED: tuftelin-interacting protein 11-like isoform 2 [Solanum lycopersicum] Length = 867 Score = 55.5 bits (132), Expect = 8e-06 Identities = 21/34 (61%), Positives = 28/34 (82%) Frame = -2 Query: 207 VLLLEDFFFSKWEQVLYYWLCSNPYFENVGQWYL 106 +L + D FF+KW++VLY+WLCSNP FE V +WYL Sbjct: 673 MLPILDIFFNKWQEVLYHWLCSNPNFEEVTKWYL 706 >ref|XP_004300043.1| PREDICTED: tuftelin-interacting protein 11-like [Fragaria vesca subsp. vesca] Length = 860 Score = 47.8 bits (112), Expect(2) = 8e-06 Identities = 20/31 (64%), Positives = 21/31 (67%) Frame = -2 Query: 201 LLEDFFFSKWEQVLYYWLCSNPYFENVGQWY 109 +LE FFF KW VLY WL SNP FE V WY Sbjct: 678 MLEKFFFPKWIHVLYQWLISNPNFEEVLNWY 708 Score = 27.3 bits (59), Expect(2) = 8e-06 Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 3/34 (8%) Frame = -1 Query: 94 LLASVCIWFDLNFGLLIMNQAI---EVIQRGLRE 2 L A+ I + LN GL +MN+A+ EV+Q GL+E Sbjct: 719 LHANESIRYQLNCGLDMMNRAVEGMEVVQPGLKE 752