BLASTX nr result
ID: Paeonia23_contig00012277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00012277 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002262897.1| PREDICTED: uncharacterized protein At3g27210... 59 7e-07 ref|XP_002509538.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002262897.1| PREDICTED: uncharacterized protein At3g27210-like [Vitis vinifera] Length = 247 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/44 (61%), Positives = 33/44 (75%) Frame = +3 Query: 6 TPYGDSKPEKEKAMKSSQCCLPRLLSSRGYDERKKKMSPAYG*N 137 TP GD K EKEK ++S+QCCLP L +R ++ERKKKMSPA N Sbjct: 201 TPNGDFKSEKEKPLRSTQCCLPSLRLNRSFNERKKKMSPAVAVN 244 >ref|XP_002509538.1| conserved hypothetical protein [Ricinus communis] gi|223549437|gb|EEF50925.1| conserved hypothetical protein [Ricinus communis] Length = 236 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +3 Query: 6 TPYGDSKPEKEKAMKSSQCCLPRLLSSRGYDERKKKMSPAYG*N 137 T GD+ E+EK++KS+QCCLP L+S R + +RKKKMSPA N Sbjct: 190 TANGDALIEREKSIKSAQCCLPSLISCRSFSDRKKKMSPAIAVN 233