BLASTX nr result
ID: Paeonia23_contig00011901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011901 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006484012.1| PREDICTED: uncharacterized protein LOC102608... 57 3e-06 ref|XP_006438154.1| hypothetical protein CICLE_v10032496mg [Citr... 57 3e-06 >ref|XP_006484012.1| PREDICTED: uncharacterized protein LOC102608643 [Citrus sinensis] Length = 258 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -1 Query: 93 EMEMMYYQVARSSYQDSLKVLEADIQYANAL 1 +ME+MYYQ+A+SSYQDSLKVLEADIQ+ANAL Sbjct: 6 DMEVMYYQLAKSSYQDSLKVLEADIQHANAL 36 >ref|XP_006438154.1| hypothetical protein CICLE_v10032496mg [Citrus clementina] gi|557540350|gb|ESR51394.1| hypothetical protein CICLE_v10032496mg [Citrus clementina] Length = 258 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -1 Query: 93 EMEMMYYQVARSSYQDSLKVLEADIQYANAL 1 +ME+MYYQ+A+SSYQDSLKVLEADIQ+ANAL Sbjct: 6 DMEVMYYQLAKSSYQDSLKVLEADIQHANAL 36