BLASTX nr result
ID: Paeonia23_contig00011859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011859 (295 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006489164.1| PREDICTED: vesicle-associated protein 2-2-li... 58 2e-06 ref|XP_006419683.1| hypothetical protein CICLE_v10005219mg [Citr... 58 2e-06 >ref|XP_006489164.1| PREDICTED: vesicle-associated protein 2-2-like isoform X1 [Citrus sinensis] Length = 357 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 RVKSGVRRVQVGFPFLFVCMVALVSVVLGYLTHP*N 110 R KS +RRVQVGFP LFVCMVAL+ +V+GYL+HP N Sbjct: 317 RRKSNLRRVQVGFPLLFVCMVALIGLVVGYLSHPQN 352 >ref|XP_006419683.1| hypothetical protein CICLE_v10005219mg [Citrus clementina] gi|567853043|ref|XP_006419685.1| hypothetical protein CICLE_v10005219mg [Citrus clementina] gi|557521556|gb|ESR32923.1| hypothetical protein CICLE_v10005219mg [Citrus clementina] gi|557521558|gb|ESR32925.1| hypothetical protein CICLE_v10005219mg [Citrus clementina] Length = 357 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = +3 Query: 3 RVKSGVRRVQVGFPFLFVCMVALVSVVLGYLTHP*N 110 R KS +RRVQVGFP LFVCMVAL+ +V+GYL+HP N Sbjct: 317 RRKSNLRRVQVGFPLLFVCMVALIGLVVGYLSHPQN 352