BLASTX nr result
ID: Paeonia23_contig00011569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011569 (313 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB26564.1| Light-inducible protein CPRF2 [Morus notabilis] 60 4e-07 >gb|EXB26564.1| Light-inducible protein CPRF2 [Morus notabilis] Length = 441 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 257 MDTLFSVDEISDPFWSSAVTEPAINRSASEWALERFLEETLKP 129 M+++FSVDEISD WSS+ PA+NRSASEWALERFLEE P Sbjct: 1 MNSVFSVDEISDGLWSSS---PAMNRSASEWALERFLEEFSSP 40