BLASTX nr result
ID: Paeonia23_contig00011550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00011550 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006385190.1| hypothetical protein POPTR_0003s00910g [Popu... 50 3e-06 >ref|XP_006385190.1| hypothetical protein POPTR_0003s00910g [Populus trichocarpa] gi|550342081|gb|ERP62987.1| hypothetical protein POPTR_0003s00910g [Populus trichocarpa] Length = 213 Score = 50.1 bits (118), Expect(2) = 3e-06 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = -2 Query: 178 IVLESSQVIATSSMVNITSYQQYMNPNPVYGVPVLTSIGRERSDGLFSGFINICSHL 8 IV+E++ + T + SYQQY+ PNPVYGVPV RE+S G F + C++L Sbjct: 91 IVMETTPIYPT-----LPSYQQYLVPNPVYGVPVEQKPRREKSTGFFGCVVTFCANL 142 Score = 26.6 bits (57), Expect(2) = 3e-06 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Frame = -3 Query: 312 CCCS--CSSTQPSAPPYSHGTKNRVTI----MPSRSSLVQIKH 202 CCCS + TQPSAPP + +T P SL ++ H Sbjct: 38 CCCSYPTAPTQPSAPPLPPWLEPELTYEAVSAPGLLSLPELAH 80