BLASTX nr result
ID: Paeonia23_contig00010748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00010748 (207 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002302559.2| hypothetical protein POPTR_0002s15440g [Popu... 59 5e-07 >ref|XP_002302559.2| hypothetical protein POPTR_0002s15440g [Populus trichocarpa] gi|550345084|gb|EEE81832.2| hypothetical protein POPTR_0002s15440g [Populus trichocarpa] Length = 169 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +1 Query: 46 PPLPNLVAALEQATLMAKQLPTTTDPTQILQIYT 147 PPLP+L+ +LEQATLMAKQLP+TTDPT +LQIY+ Sbjct: 9 PPLPDLILSLEQATLMAKQLPSTTDPTHLLQIYS 42