BLASTX nr result
ID: Paeonia23_contig00009975
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00009975 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007043779.1| Zinc finger family protein isoform 2 [Theobr... 55 8e-06 ref|XP_007043778.1| Zinc finger family protein isoform 1 [Theobr... 55 8e-06 >ref|XP_007043779.1| Zinc finger family protein isoform 2 [Theobroma cacao] gi|508707714|gb|EOX99610.1| Zinc finger family protein isoform 2 [Theobroma cacao] Length = 659 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/50 (50%), Positives = 29/50 (58%) Frame = -1 Query: 221 NDLIVHVHVNCNTSFQRMIQVSPQKTAGGHNLCLKCFQKWVRQGKCTCIN 72 ND++ + N N S + P T GHN CLKCFQKWV QGK TC N Sbjct: 133 NDVLAILDENINCSICMQLPERPVTTPCGHNFCLKCFQKWVAQGKRTCAN 182 >ref|XP_007043778.1| Zinc finger family protein isoform 1 [Theobroma cacao] gi|508707713|gb|EOX99609.1| Zinc finger family protein isoform 1 [Theobroma cacao] Length = 738 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/50 (50%), Positives = 29/50 (58%) Frame = -1 Query: 221 NDLIVHVHVNCNTSFQRMIQVSPQKTAGGHNLCLKCFQKWVRQGKCTCIN 72 ND++ + N N S + P T GHN CLKCFQKWV QGK TC N Sbjct: 133 NDVLAILDENINCSICMQLPERPVTTPCGHNFCLKCFQKWVAQGKRTCAN 182