BLASTX nr result
ID: Paeonia23_contig00009807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00009807 (563 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB62651.1| Translation initiation factor eIF-2B subunit beta... 72 8e-11 ref|XP_006470844.1| PREDICTED: translation initiation factor eIF... 72 8e-11 ref|XP_006431425.1| hypothetical protein CICLE_v10001295mg [Citr... 72 8e-11 ref|XP_006431419.1| hypothetical protein CICLE_v10001295mg [Citr... 72 8e-11 ref|XP_006420748.1| hypothetical protein CICLE_v10005415mg [Citr... 72 8e-11 ref|XP_006420747.1| hypothetical protein CICLE_v10005415mg [Citr... 72 8e-11 ref|XP_006420746.1| hypothetical protein CICLE_v10005415mg [Citr... 72 8e-11 ref|XP_002297747.2| eukaryotic translation initiation factor 2B ... 72 8e-11 ref|XP_007011105.1| NagB/RpiA/CoA transferase-like superfamily p... 72 8e-11 ref|XP_007011102.1| NagB/RpiA/CoA transferase-like superfamily p... 72 8e-11 ref|XP_004307122.1| PREDICTED: translation initiation factor eIF... 72 8e-11 ref|XP_007218071.1| hypothetical protein PRUPE_ppa006329mg [Prun... 72 8e-11 ref|XP_002272876.2| PREDICTED: translation initiation factor eIF... 72 8e-11 ref|XP_006830361.1| hypothetical protein AMTR_s00116p00093870 [A... 71 2e-10 ref|XP_004512575.1| PREDICTED: translation initiation factor eIF... 71 2e-10 ref|XP_003543164.1| PREDICTED: translation initiation factor eIF... 71 2e-10 ref|XP_003528945.1| PREDICTED: translation initiation factor eIF... 71 2e-10 ref|XP_003613023.1| Translation initiation factor eIF-2B subunit... 71 2e-10 gb|ACU21071.1| unknown [Glycine max] 71 2e-10 ref|XP_002304788.1| eukaryotic translation initiation factor 2B ... 71 2e-10 >gb|EXB62651.1| Translation initiation factor eIF-2B subunit beta [Morus notabilis] Length = 417 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 374 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006470844.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X1 [Citrus sinensis] gi|568833313|ref|XP_006470845.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X2 [Citrus sinensis] gi|568833315|ref|XP_006470846.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X3 [Citrus sinensis] gi|568833317|ref|XP_006470847.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform X4 [Citrus sinensis] Length = 417 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 374 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006431425.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533547|gb|ESR44665.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] Length = 419 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 376 VPPKLVSLFITDAGGHNPSYMYRLIADYYSADDLVVQRR 414 >ref|XP_006431419.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|567877723|ref|XP_006431420.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|567877729|ref|XP_006431423.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|567877731|ref|XP_006431424.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533541|gb|ESR44659.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533542|gb|ESR44660.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533545|gb|ESR44663.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] gi|557533546|gb|ESR44664.1| hypothetical protein CICLE_v10001295mg [Citrus clementina] Length = 417 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 374 VPPKLVSLFITDAGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006420748.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|567855259|ref|XP_006420749.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|557522621|gb|ESR33988.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|557522622|gb|ESR33989.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] Length = 417 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 374 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006420747.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|557522620|gb|ESR33987.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] Length = 375 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 332 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 370 >ref|XP_006420746.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] gi|557522619|gb|ESR33986.1| hypothetical protein CICLE_v10005415mg [Citrus clementina] Length = 375 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 332 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 370 >ref|XP_002297747.2| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] gi|550346654|gb|EEE82552.2| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] Length = 419 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 376 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 414 >ref|XP_007011105.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] gi|590569574|ref|XP_007011106.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] gi|508728018|gb|EOY19915.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] gi|508728019|gb|EOY19916.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 4 [Theobroma cacao] Length = 322 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 279 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 317 >ref|XP_007011102.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|590569565|ref|XP_007011103.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|590569568|ref|XP_007011104.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|508728015|gb|EOY19912.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|508728016|gb|EOY19913.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] gi|508728017|gb|EOY19914.1| NagB/RpiA/CoA transferase-like superfamily protein isoform 1 [Theobroma cacao] Length = 417 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 374 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_004307122.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Fragaria vesca subsp. vesca] Length = 416 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 373 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 411 >ref|XP_007218071.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] gi|596000490|ref|XP_007218072.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] gi|462414533|gb|EMJ19270.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] gi|462414534|gb|EMJ19271.1| hypothetical protein PRUPE_ppa006329mg [Prunus persica] Length = 417 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 374 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_002272876.2| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform 1 [Vitis vinifera] gi|359487220|ref|XP_003633538.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like isoform 2 [Vitis vinifera] gi|297742689|emb|CBI35142.3| unnamed protein product [Vitis vinifera] Length = 417 Score = 72.4 bits (176), Expect = 8e-11 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQR+ Sbjct: 374 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQRR 412 >ref|XP_006830361.1| hypothetical protein AMTR_s00116p00093870 [Amborella trichopoda] gi|548836631|gb|ERM97777.1| hypothetical protein AMTR_s00116p00093870 [Amborella trichopoda] Length = 417 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVVQ++ Sbjct: 373 VPPQLVSLFITDTGGHNPSYMYRLIADYYSADDLVVQQQ 411 >ref|XP_004512575.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Cicer arietinum] Length = 415 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVV+R+ Sbjct: 372 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVKRR 410 >ref|XP_003543164.1| PREDICTED: translation initiation factor eIF-2B subunit beta [Glycine max] Length = 415 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVV+R+ Sbjct: 372 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVKRR 410 >ref|XP_003528945.1| PREDICTED: translation initiation factor eIF-2B subunit beta-like [Glycine max] Length = 415 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVV+R+ Sbjct: 372 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVKRR 410 >ref|XP_003613023.1| Translation initiation factor eIF-2B subunit beta [Medicago truncatula] gi|355514358|gb|AES95981.1| Translation initiation factor eIF-2B subunit beta [Medicago truncatula] Length = 413 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVV+R+ Sbjct: 370 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVKRR 408 >gb|ACU21071.1| unknown [Glycine max] Length = 143 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVV+R+ Sbjct: 100 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVKRR 138 >ref|XP_002304788.1| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] gi|222842220|gb|EEE79767.1| eukaryotic translation initiation factor 2B family protein [Populus trichocarpa] Length = 420 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 563 VPPELVSLFITDIGVHNPSYIYRLIADYYSSDDLVVQRK 447 VPP+LVSLFITD G HNPSY+YRLIADYYS+DDLVV+R+ Sbjct: 377 VPPKLVSLFITDTGGHNPSYMYRLIADYYSADDLVVRRR 415