BLASTX nr result
ID: Paeonia23_contig00009487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00009487 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002438004.1| hypothetical protein SORBIDRAFT_10g006310 [S... 43 5e-06 ref|XP_002518961.1| alcohol dehydrogenase, putative [Ricinus com... 56 6e-06 >ref|XP_002438004.1| hypothetical protein SORBIDRAFT_10g006310 [Sorghum bicolor] gi|241916227|gb|EER89371.1| hypothetical protein SORBIDRAFT_10g006310 [Sorghum bicolor] Length = 154 Score = 43.1 bits (100), Expect(2) = 5e-06 Identities = 20/38 (52%), Positives = 26/38 (68%) Frame = +2 Query: 11 MSSECAKEDCLGWAARDPSGVLSRYKFSRR*TFNTYIS 124 M++E C WAARDPSG+LS YKF+RR N+ I+ Sbjct: 1 MAAESENGSCNAWAARDPSGILSPYKFNRRAMQNSDIA 38 Score = 32.7 bits (73), Expect(2) = 5e-06 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 238 RVLGGDDISLKITHCGVCYADAIWT 312 R + DI+ K+ +C VCYAD WT Sbjct: 30 RAMQNSDIATKVIYCRVCYADVGWT 54 >ref|XP_002518961.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223541948|gb|EEF43494.1| alcohol dehydrogenase, putative [Ricinus communis] Length = 358 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/39 (71%), Positives = 29/39 (74%) Frame = +2 Query: 11 MSSECAKEDCLGWAARDPSGVLSRYKFSRR*TFNTYISL 127 MSS+ KEDCL WAARDPSGVLS YKFSRR ISL Sbjct: 1 MSSQSVKEDCLAWAARDPSGVLSPYKFSRRAVGEDDISL 39