BLASTX nr result
ID: Paeonia23_contig00009216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00009216 (322 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulg... 120 1e-27 >ref|NP_064004.1| orf107b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|323435151|ref|YP_004222369.1| hypothetical protein BevumaM_p136 [Beta vulgaris subsp. maritima] gi|346683242|ref|YP_004842174.1| hypothetical protein BemaM_p130 [Beta macrocarpa] gi|9049306|dbj|BAA99316.1| orf107b [Beta vulgaris subsp. vulgaris] gi|317905601|emb|CBJ14008.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|319439884|emb|CBJ17584.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|320148038|emb|CBJ20702.1| hypothetical protein [Beta vulgaris subsp. maritima] gi|345500160|emb|CBX24979.1| hypothetical protein [Beta macrocarpa] gi|384977914|emb|CBL54138.1| hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 107 Score = 120 bits (300), Expect(2) = 1e-27 Identities = 61/68 (89%), Positives = 63/68 (92%) Frame = -3 Query: 281 HHTTRIDANPPRYRTCDSHRIRLAQRLLNPSQAFSSTSPLQQSSIKLSFPRRYEMGVFPS 102 HHTTRIDANPPRYRTCDSHRIRLAQRLLNPS+AFSST PL QSSIKL+F RR EMGVFPS Sbjct: 20 HHTTRIDANPPRYRTCDSHRIRLAQRLLNPSRAFSSTFPL-QSSIKLAFSRRSEMGVFPS 78 Query: 101 PIVYIGLA 78 PIV IGLA Sbjct: 79 PIVCIGLA 86 Score = 28.5 bits (62), Expect(2) = 1e-27 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = -1 Query: 322 RPIDHGTNRVG 290 RPIDHGTNRVG Sbjct: 6 RPIDHGTNRVG 16