BLASTX nr result
ID: Paeonia23_contig00006857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00006857 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32716.1| hypothetical protein MIMGU_mgv1a005324mg [Mimulus... 61 2e-07 >gb|EYU32716.1| hypothetical protein MIMGU_mgv1a005324mg [Mimulus guttatus] Length = 489 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -3 Query: 128 MGTDVVALQHADLAEKVIPSSNGHGCCKKGPGYATPLEAMSG 3 M TD+V LQHAD + + NG+GCCKKGPGYATPL AMSG Sbjct: 1 MATDMVVLQHAD-----VENGNGNGCCKKGPGYATPLAAMSG 37