BLASTX nr result
ID: Paeonia23_contig00006744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00006744 (626 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB91775.1| methionine aminopeptidase 2 [Ananas comosus] 48 5e-06 emb|CAB75818.1| putative protein [Arabidopsis thaliana] 48 5e-06 >gb|ABB91775.1| methionine aminopeptidase 2 [Ananas comosus] Length = 460 Score = 47.8 bits (112), Expect(2) = 5e-06 Identities = 24/53 (45%), Positives = 34/53 (64%) Frame = -1 Query: 212 QKQEK*RIAYAQR*IQQYKASIHHLVRKYIRSVLKPIVLMIIFCEALKNTIRE 54 +K+E R+ I + A +H VRKYIRS+LKP +LMI CE L+N +R+ Sbjct: 136 EKRELERLEKPMYNIVRRAAEVHRQVRKYIRSILKPGILMIDLCETLENMVRK 188 Score = 28.9 bits (63), Expect(2) = 5e-06 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 58 ENGLQPSIDFLAGFSLNWV 2 ENGLQ I F G SLNWV Sbjct: 192 ENGLQAGIAFPTGCSLNWV 210 >emb|CAB75818.1| putative protein [Arabidopsis thaliana] Length = 435 Score = 47.8 bits (112), Expect(2) = 5e-06 Identities = 25/69 (36%), Positives = 40/69 (57%) Frame = -1 Query: 260 MKNIEDEGKGAENEEIQKQEK*RIAYAQR*IQQYKASIHHLVRKYIRSVLKPIVLMIIFC 81 ++ +DE E E+++ EK +R A +H VRKY+RS++KP +LM C Sbjct: 100 IQEYKDETTSEEKRELERFEKPIYNSVRR-----AAEVHRQVRKYVRSIVKPGMLMTDIC 154 Query: 80 EALKNTIRE 54 E L+NT+R+ Sbjct: 155 ETLENTVRK 163 Score = 28.9 bits (63), Expect(2) = 5e-06 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 58 ENGLQPSIDFLAGFSLNWV 2 ENGLQ I F G SLNWV Sbjct: 167 ENGLQAGIAFPTGCSLNWV 185