BLASTX nr result
ID: Paeonia23_contig00006458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00006458 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, part... 50 6e-06 >ref|XP_007216161.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] gi|462412311|gb|EMJ17360.1| hypothetical protein PRUPE_ppa015308mg, partial [Prunus persica] Length = 1150 Score = 50.4 bits (119), Expect(2) = 6e-06 Identities = 27/49 (55%), Positives = 31/49 (63%) Frame = -1 Query: 240 QNIGL*TPLPDPNSIL*DT*MDFVLGVQQTQKGKDSFMVVVDNSPRRLT 94 QN GL PLP PN I D MDFVLG+ +TQ+G DS VVVD + T Sbjct: 923 QNTGLYMPLPVPNDIWQDLAMDFVLGLPRTQRGVDSVFVVVDRFSKMAT 971 Score = 25.0 bits (53), Expect(2) = 6e-06 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 341 GRNKTIVQAEERYY 300 GR+KTIV EER+Y Sbjct: 884 GRDKTIVGTEERFY 897