BLASTX nr result
ID: Paeonia23_contig00006380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00006380 (1167 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004515861.1| PREDICTED: high-affinity nitrate transporter... 62 5e-07 gb|AFK44790.1| unknown [Medicago truncatula] 60 2e-06 >ref|XP_004515861.1| PREDICTED: high-affinity nitrate transporter 3.1-like [Cicer arietinum] Length = 205 Score = 62.0 bits (149), Expect = 5e-07 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +3 Query: 339 AARRLLGVSLLLCCVAETCYGIVLFSSLQHTLVVTASPKQGQ 464 AA +L+ SLLLCC+AETCYG VLF+SL+ TL VTASPK GQ Sbjct: 2 AAHKLIVASLLLCCLAETCYGKVLFTSLKRTLDVTASPKLGQ 43 >gb|AFK44790.1| unknown [Medicago truncatula] Length = 206 Score = 59.7 bits (143), Expect = 2e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +3 Query: 339 AARRLLGVSLLLCCVAETCYGIVLFSSLQHTLVVTASPKQGQ 464 AA +L+ SLLLCC+AE CYG LFSSL+ T+ VTASPKQGQ Sbjct: 2 AAHKLVVASLLLCCLAEICYGKDLFSSLKRTIDVTASPKQGQ 43