BLASTX nr result
ID: Paeonia23_contig00006193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00006193 (609 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005090199.1| rpl33 gene product (chloroplast) [Ricinus co... 110 4e-22 gb|ADD30192.1| ribosomal protein L33 [Plumbago auriculata] 109 7e-22 ref|XP_006435533.1| hypothetical protein CICLE_v10033989mg [Citr... 108 9e-22 ref|YP_006666051.1| ribosomal protein L33 (chloroplast) [Capsicu... 108 9e-22 gb|AEX94909.1| ribosomal protein L33 (chloroplast) [Aphyllanthes... 108 1e-21 ref|YP_008994310.1| ribosomal protein L33 [Melianthus villosus] ... 108 2e-21 gb|AGW97972.1| ribosomal protein L33 (chloroplast) [Ipomoea setosa] 108 2e-21 ref|NP_054522.1| ribosomal protein L33 [Nicotiana tabacum] gi|28... 108 2e-21 gb|AEX94915.1| ribosomal protein L33 (chloroplast) [Haworthia cy... 108 2e-21 ref|YP_001542468.1| ribosomal protein L33 [Ceratophyllum demersu... 108 2e-21 ref|NP_054956.1| ribosomal protein L33 [Spinacia oleracea] gi|12... 107 2e-21 ref|YP_538956.1| ribosomal protein L33 [Gossypium hirsutum] gi|1... 107 2e-21 ref|YP_538869.1| ribosomal protein L33 [Solanum bulbocastanum] g... 107 3e-21 ref|YP_817503.1| ribosomal protein L33 [Coffea arabica] gi|12215... 107 3e-21 ref|YP_740496.1| ribosomal protein L33 [Citrus sinensis] gi|1221... 107 3e-21 ref|YP_009019812.1| ribosomal protein L33 (chloroplast) [Vitis r... 107 3e-21 gb|AFB74274.1| 50S ribosomal protein L33, partial (chloroplast) ... 107 3e-21 ref|YP_001294205.1| ribosomal protein L33 [Buxus microphylla] gi... 107 3e-21 ref|YP_008577683.1| ribosomal protein L33 (chloroplast) [Corymbi... 106 5e-21 ref|YP_086987.1| ribosomal protein L33 [Panax ginseng] gi|558602... 106 5e-21 >ref|YP_005090199.1| rpl33 gene product (chloroplast) [Ricinus communis] gi|339516186|gb|AEJ82576.1| ribosomal protein L33 [Ricinus communis] Length = 66 Score = 110 bits (274), Expect = 4e-22 Identities = 49/66 (74%), Positives = 57/66 (86%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRVR+ILECT C Q + +K S GISRY T+KNRHN+PSR+EL+KFCPYC KHT+ Sbjct: 1 MAKGKDVRVRVILECTSCVQNSVNKKSTGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >gb|ADD30192.1| ribosomal protein L33 [Plumbago auriculata] Length = 66 Score = 109 bits (272), Expect = 7e-22 Identities = 49/66 (74%), Positives = 58/66 (87%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRVRIILECT C +K+ +K S GISRY T+KNRHN+PS +EL+KFCPYC+KHT+ Sbjct: 1 MAKGKDVRVRIILECTSCVRKSVNKESRGISRYITQKNRHNTPSGLELRKFCPYCSKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|XP_006435533.1| hypothetical protein CICLE_v10033989mg [Citrus clementina] gi|557537729|gb|ESR48773.1| hypothetical protein CICLE_v10033989mg [Citrus clementina] Length = 66 Score = 108 bits (271), Expect = 9e-22 Identities = 49/66 (74%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK K+VRVR+ILECT C Q +K S GISRY T+KNRHN+PSR+EL+KFCPYC KHTL Sbjct: 1 MAKGKEVRVRVILECTSCVQNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_006666051.1| ribosomal protein L33 (chloroplast) [Capsicum annuum] gi|401065953|gb|AFP90797.1| ribosomal protein L33 (chloroplast) [Capsicum annuum] Length = 66 Score = 108 bits (271), Expect = 9e-22 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRV +ILECT C + + K+S GISRY+T+KNRHN+P+R+ELKKFCPYC KHT+ Sbjct: 1 MAKGKDVRVTVILECTSCVRNSVDKVSRGISRYSTQKNRHNTPNRLELKKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >gb|AEX94909.1| ribosomal protein L33 (chloroplast) [Aphyllanthes monspeliensis] Length = 66 Score = 108 bits (270), Expect = 1e-21 Identities = 48/66 (72%), Positives = 58/66 (87%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRVR+ILECT C Q + +K S GISRYTT+KNRHN+PSR++L+KFC YC+KHT+ Sbjct: 1 MAKGKDVRVRVILECTSCIQNSVNKESRGISRYTTQKNRHNTPSRLDLRKFCRYCHKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_008994310.1| ribosomal protein L33 [Melianthus villosus] gi|527355160|gb|AGS13029.1| ribosomal protein L33 [Melianthus villosus] Length = 66 Score = 108 bits (269), Expect = 2e-21 Identities = 48/66 (72%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRV +ILECT C + SK S GISRY T+KNRHN+PSR+EL+KFCPYC+KHT+ Sbjct: 1 MAKGKDVRVTVILECTSCVRNGVSKESTGISRYITQKNRHNTPSRLELRKFCPYCSKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >gb|AGW97972.1| ribosomal protein L33 (chloroplast) [Ipomoea setosa] Length = 66 Score = 108 bits (269), Expect = 2e-21 Identities = 46/66 (69%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK+KD RV +ILECTCC + +K+S GISRY T+KNRHN+P+ +ELKKFCPYC KHT+ Sbjct: 1 MAKSKDARVAVILECTCCVRNGVNKVSTGISRYITQKNRHNTPNPLELKKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|NP_054522.1| ribosomal protein L33 [Nicotiana tabacum] gi|28261738|ref|NP_783253.1| ribosomal protein L33 [Atropa belladonna] gi|78102559|ref|YP_358700.1| ribosomal protein L33 [Nicotiana sylvestris] gi|81301589|ref|YP_398886.1| ribosomal protein L33 [Nicotiana tomentosiformis] gi|351653903|ref|YP_004891628.1| rpl33 gene product (chloroplast) [Nicotiana undulata] gi|394831122|ref|YP_006503812.1| ribosomal protein L33 (chloroplast) [Datura stramonium] gi|132901|sp|P06393.3|RK33_TOBAC RecName: Full=50S ribosomal protein L33, chloroplastic gi|68053184|sp|Q7FNS6.1|RK33_ATRBE RecName: Full=50S ribosomal protein L33, chloroplastic gi|122212891|sp|Q33C11.1|RK33_NICTO RecName: Full=50S ribosomal protein L33, chloroplastic gi|122213566|sp|Q3C1K8.1|RK33_NICSY RecName: Full=50S ribosomal protein L33, chloroplastic gi|11850|emb|CAA77370.1| ribosomal protein L33 [Nicotiana tabacum] gi|20068352|emb|CAC88065.1| ribosomal protein L33 [Atropa belladonna] gi|77799586|dbj|BAE46675.1| ribosomal protein L33 [Nicotiana sylvestris] gi|80750948|dbj|BAE48024.1| ribosomal protein L33 [Nicotiana tomentosiformis] gi|347453929|gb|AEO95587.1| ribosomal protein L33 (chloroplast) [Nicotiana undulata] gi|347454040|gb|AEO95697.1| ribosomal protein L33 [synthetic construct] gi|350996447|gb|AEQ36959.1| ribosomal protein L33 (chloroplast) [Datura stramonium] gi|350996533|gb|AEQ37044.1| ribosomal protein L33 [Datura stramonium] gi|225219|prf||1211235BA ribosomal protein L33 Length = 66 Score = 108 bits (269), Expect = 2e-21 Identities = 47/66 (71%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRV +ILECT C + + K+S GISRY T+KNRHN+P+R+ELKKFCPYC KHT+ Sbjct: 1 MAKGKDVRVTVILECTSCVRNSVDKVSRGISRYITQKNRHNTPNRLELKKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >gb|AEX94915.1| ribosomal protein L33 (chloroplast) [Haworthia cymbiformis] Length = 66 Score = 108 bits (269), Expect = 2e-21 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRVR+ILECTCC Q +K S GISRY T+KNRHN+P+R++L+KFC YC+KHT+ Sbjct: 1 MAKGKDVRVRVILECTCCVQNGVNKESPGISRYITQKNRHNTPNRLDLRKFCRYCHKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_001542468.1| ribosomal protein L33 [Ceratophyllum demersum] gi|218546840|sp|A8SEC4.1|RK33_CERDE RecName: Full=50S ribosomal protein L33, chloroplastic gi|148508464|gb|ABQ81471.1| ribosomal protein L33 [Ceratophyllum demersum] Length = 66 Score = 108 bits (269), Expect = 2e-21 Identities = 48/66 (72%), Positives = 55/66 (83%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRVR+ILECT C + +K S GISRY T+KNRHN+PSR+EL+KFCPYC KHT Sbjct: 1 MAKGKDVRVRVILECTSCARNGGNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTT 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|NP_054956.1| ribosomal protein L33 [Spinacia oleracea] gi|12644187|sp|P28805.3|RK33_SPIOL RecName: Full=50S ribosomal protein L33, chloroplastic gi|189096151|pdb|3BBO|3 Chain 3, Homology Model For The Spinach Chloroplast 50s Subunit Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome gi|7636129|emb|CAB88749.1| ribosomal protein L33 [Spinacia oleracea] Length = 66 Score = 107 bits (268), Expect = 2e-21 Identities = 47/66 (71%), Positives = 58/66 (87%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRV++ILECT C +K+ +K S G+SRY T+KNRHN+PSR+EL+KFCPYC KHT+ Sbjct: 1 MAKGKDVRVKVILECTGCVRKSVNKGSRGVSRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_538956.1| ribosomal protein L33 [Gossypium hirsutum] gi|119368520|ref|YP_913208.1| ribosomal protein L33 [Gossypium barbadense] gi|313199723|ref|YP_004021337.1| ribosomal protein L33 [Theobroma cacao] gi|325210950|ref|YP_004286025.1| ribosomal protein L33 [Gossypium thurberi] gi|372290952|ref|YP_005087714.1| ribosomal protein L33 (chloroplast) [Gossypium raimondii] gi|372291053|ref|YP_005087810.1| ribosomal protein L33 (chloroplast) [Gossypium darwinii] gi|372291407|ref|YP_005088301.1| ribosomal protein L33 (chloroplast) [Gossypium tomentosum] gi|372291505|ref|YP_005088397.1| ribosomal protein L33 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|372291795|ref|YP_005088937.1| ribosomal protein L33 (chloroplast) [Gossypium mustelinum] gi|372291879|ref|YP_005089020.1| ribosomal protein L33 (chloroplast) [Gossypium arboreum] gi|386800859|ref|YP_006303512.1| ribosomal protein L33 (chloroplast) [Gossypium gossypioides] gi|394830648|ref|YP_006503298.1| ribosomal protein L33 (chloroplast) [Gossypium incanum] gi|394830735|ref|YP_006503381.1| ribosomal protein L33 (chloroplast) [Gossypium somalense] gi|394830821|ref|YP_006503464.1| ribosomal protein L33 (chloroplast) [Gossypium capitis-viridis] gi|394830910|ref|YP_006503547.1| ribosomal protein L33 (chloroplast) [Gossypium areysianum] gi|394830997|ref|YP_006503630.1| ribosomal protein L33 (chloroplast) [Gossypium robinsonii] gi|570758901|ref|YP_008992485.1| ribosomal protein L33 (chloroplast) [Gossypium anomalum] gi|570758989|ref|YP_008992571.1| ribosomal protein L33 (chloroplast) [Gossypium bickii] gi|570759077|ref|YP_008992916.1| ribosomal protein L33 (chloroplast) [Gossypium sturtianum] gi|570759597|ref|YP_008992658.1| ribosomal protein L33 (chloroplast) [Gossypium herbaceum] gi|570759683|ref|YP_008992744.1| ribosomal protein L33 (chloroplast) [Gossypium longicalyx] gi|570879934|ref|YP_008992830.1| ribosomal protein L33 (chloroplast) [Gossypium stocksii] gi|122201404|sp|Q2L929.1|RK33_GOSHI RecName: Full=50S ribosomal protein L33, chloroplastic gi|125987612|sp|A0ZZ56.1|RK33_GOSBA RecName: Full=50S ribosomal protein L33, chloroplastic gi|85687437|gb|ABC73649.1| ribosomal protein L33 [Gossypium hirsutum] gi|119224882|dbj|BAF41268.1| Ribosomal protein L33 [Gossypium barbadense] gi|290775812|gb|ADD62308.1| ribosomal protein L33 [Gossypium thurberi] gi|309321287|gb|ADO64830.1| ribosomal protein L33 [Theobroma cacao] gi|318084338|gb|ADV38814.1| ribosomal protein L33 (chloroplast) [Gossypium arboreum] gi|318084421|gb|ADV38896.1| ribosomal protein L33 (chloroplast) [Gossypium darwinii] gi|318084506|gb|ADV38980.1| ribosomal protein L33 (chloroplast) [Gossypium herbaceum subsp. africanum] gi|318084590|gb|ADV39063.1| ribosomal protein L33 (chloroplast) [Gossypium mustelinum] gi|318084670|gb|ADV39142.1| ribosomal protein L33 (chloroplast) [Gossypium raimondii] gi|318084758|gb|ADV39229.1| ribosomal protein L33 (chloroplast) [Gossypium tomentosum] gi|326457060|gb|ADZ74324.1| ribosomal protein L33 [Gossypium anomalum] gi|326457148|gb|ADZ74411.1| ribosomal protein L33 [Gossypium bickii] gi|326457236|gb|ADZ74498.1| ribosomal protein L33 [Gossypium herbaceum] gi|326457322|gb|ADZ74583.1| ribosomal protein L33 [Gossypium longicalyx] gi|326457409|gb|ADZ74669.1| ribosomal protein L33 [Gossypium stocksii] gi|326457497|gb|ADZ74756.1| ribosomal protein L33 [Gossypium sturtianum] gi|328924801|gb|ADO64911.2| ribosomal protein L33 [Theobroma cacao] gi|329317093|gb|AEB90452.1| ribosomal protein L33 (chloroplast) [Gossypium gossypioides] gi|329317177|gb|AEB90535.1| ribosomal protein L33 (chloroplast) [Gossypium hirsutum] gi|329317261|gb|AEB90618.1| ribosomal protein L33 (chloroplast) [Gossypium hirsutum] gi|329317345|gb|AEB90701.1| ribosomal protein L33 (chloroplast) [Gossypium barbadense] gi|329317429|gb|AEB90784.1| ribosomal protein L33 (chloroplast) [Gossypium barbadense] gi|329317513|gb|AEB90867.1| ribosomal protein L33 (chloroplast) [Gossypium barbadense] gi|335354353|gb|AEH42973.1| ribosomal protein L33 [Gossypium incanum] gi|335354437|gb|AEH43056.1| ribosomal protein L33 [Gossypium somalense] gi|335354521|gb|AEH43139.1| ribosomal protein L33 (chloroplast) [Gossypium capitis-viridis] gi|335354605|gb|AEH43222.1| ribosomal protein L33 (chloroplast) [Gossypium areysianum] gi|335354689|gb|AEH43305.1| ribosomal protein L33 [Gossypium robinsonii] gi|371925957|gb|AEX57747.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926039|gb|AEX57828.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926121|gb|AEX57909.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926203|gb|AEX57990.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926285|gb|AEX58071.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926367|gb|AEX58152.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926449|gb|AEX58233.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926531|gb|AEX58314.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926613|gb|AEX58395.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] gi|371926695|gb|AEX58476.1| ribosomal protein L33 (chloroplast) [Theobroma grandiflorum] gi|371926777|gb|AEX58557.1| ribosomal protein L33 (chloroplast) [Theobroma cacao] Length = 66 Score = 107 bits (268), Expect = 2e-21 Identities = 49/66 (74%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK+KDVRV IILECT C + +K S GISRY T+KNRHN+PSR+ELKKFCPYC KHT+ Sbjct: 1 MAKSKDVRVTIILECTSCVRNGVNKESTGISRYITQKNRHNTPSRLELKKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_538869.1| ribosomal protein L33 [Solanum bulbocastanum] gi|108773151|ref|YP_635660.1| ribosomal protein L33 [Solanum tuberosum] gi|544163634|ref|YP_008563109.1| ribosomal protein L33 (chloroplast) [Solanum lycopersicum] gi|544170692|ref|AP_004949.1| ribosomal protein L33 (chloroplast) [Solanum lycopersicum] gi|122201773|sp|Q2MI79.1|RK33_SOLLC RecName: Full=50S ribosomal protein L33, chloroplastic gi|122201815|sp|Q2MIG6.1|RK33_SOLBU RecName: Full=50S ribosomal protein L33, chloroplastic gi|122209882|sp|Q2VEF7.1|RK33_SOLTU RecName: Full=50S ribosomal protein L33, chloroplastic gi|82754647|gb|ABB90061.1| ribosomal protein L33 [Solanum tuberosum] gi|84371916|gb|ABC56234.1| ribosomal protein L33 [Solanum bulbocastanum] gi|84372004|gb|ABC56321.1| ribosomal protein L33 (chloroplast) [Solanum lycopersicum] gi|88656825|gb|ABD47078.1| ribosomal protein L33 [Solanum tuberosum] gi|89241692|emb|CAJ32414.1| ribosomal protein L33 [Solanum lycopersicum] gi|329124603|gb|AEB72160.1| ribosomal protein L33 (chloroplast) [Solanum tuberosum] gi|329124690|gb|AEB72246.1| ribosomal protein L33 (chloroplast) [Solanum tuberosum] gi|478733663|gb|AGJ51274.1| ribosomal protein L33 (chloroplast) [Solanum carolinense] Length = 66 Score = 107 bits (267), Expect = 3e-21 Identities = 47/66 (71%), Positives = 55/66 (83%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRV +ILECT C + + K+S GISRY T+KNRHN+P+R ELKKFCPYC KHT+ Sbjct: 1 MAKGKDVRVTVILECTSCVRNSVDKVSRGISRYITQKNRHNTPNRFELKKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_817503.1| ribosomal protein L33 [Coffea arabica] gi|122153641|sp|A0A356.1|RK33_COFAR RecName: Full=50S ribosomal protein L33, chloroplastic gi|116242185|gb|ABJ89700.1| ribosomal protein L33 [Coffea arabica] Length = 66 Score = 107 bits (267), Expect = 3e-21 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRV +ILECT C + + +K+S GISRY T+KNRHN+P+R+ELKKFCPYC KHT+ Sbjct: 1 MAKGKDVRVTVILECTDCVRNSVNKVSTGISRYITQKNRHNTPNRLELKKFCPYCYKHTV 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_740496.1| ribosomal protein L33 [Citrus sinensis] gi|122166162|sp|Q09MF7.1|RK33_CITSI RecName: Full=50S ribosomal protein L33, chloroplastic gi|113952643|gb|ABI49041.1| ribosomal protein L33 [Citrus sinensis] Length = 66 Score = 107 bits (267), Expect = 3e-21 Identities = 48/66 (72%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK K+VRVR+ILECT C + +K S GISRY T+KNRHN+PSR+EL+KFCPYC KHTL Sbjct: 1 MAKGKEVRVRVILECTSCVRNGVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTL 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_009019812.1| ribosomal protein L33 (chloroplast) [Vitis rotundifolia] gi|586947433|gb|AHJ91230.1| ribosomal protein L33 (chloroplast) [Vitis rotundifolia] Length = 66 Score = 107 bits (266), Expect = 3e-21 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KD R+R++LECT C + +K S GISRY TEKNRHN+P R+ELKKFCPYC+KHT+ Sbjct: 1 MAKGKDARIRVLLECTSCVRDGVNKESTGISRYITEKNRHNTPGRLELKKFCPYCSKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >gb|AFB74274.1| 50S ribosomal protein L33, partial (chloroplast) [Anredera baselloides] gi|377657693|gb|AFB74280.1| 50S ribosomal protein L33, partial (chloroplast) [Portulacaria afra] Length = 66 Score = 107 bits (266), Expect = 3e-21 Identities = 47/66 (71%), Positives = 57/66 (86%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KD RV++ILECT C +K+ +K S GISRY T+KNRHN+PSR+EL+KFCPYC KHT+ Sbjct: 1 MAKGKDARVKVILECTGCVRKSVNKESRGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_001294205.1| ribosomal protein L33 [Buxus microphylla] gi|218546837|sp|A6MM57.1|RK33_BUXMI RecName: Full=50S ribosomal protein L33, chloroplastic gi|146762306|gb|ABQ45270.1| ribosomal protein L33 [Buxus microphylla] Length = 66 Score = 107 bits (266), Expect = 3e-21 Identities = 48/66 (72%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRVR+ILECT C + +K S GISRY T+KNRHN+PSR+EL+KFCPYC KHT+ Sbjct: 1 MAKGKDVRVRVILECTSCVRNGVNKESLGISRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_008577683.1| ribosomal protein L33 (chloroplast) [Corymbia maculata] gi|545718931|ref|YP_008577768.1| ribosomal protein L33 (chloroplast) [Corymbia eximia] gi|442568925|gb|AGC59092.1| ribosomal protein L33 (chloroplast) [Corymbia maculata] gi|442569011|gb|AGC59177.1| ribosomal protein L33 (chloroplast) [Corymbia eximia] Length = 66 Score = 106 bits (265), Expect = 5e-21 Identities = 47/66 (71%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVRVR+ILECT C + +K S G+SRY T+KNRHN+PSR+EL+KFCPYC KHT+ Sbjct: 1 MAKGKDVRVRVILECTNCVRNGLNKESRGVSRYITQKNRHNTPSRLELRKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66 >ref|YP_086987.1| ribosomal protein L33 [Panax ginseng] gi|558602933|ref|YP_008814964.1| ribosomal protein L33 (chloroplast) [Brassaiopsis hainla] gi|558603021|ref|YP_008815051.1| ribosomal protein L33 (chloroplast) [Metapanax delavayi] gi|558603109|ref|YP_008815138.1| ribosomal protein L33 (chloroplast) [Schefflera delavayi] gi|563940300|ref|YP_008814877.1| ribosomal protein L33 (chloroplast) [Aralia undulata] gi|68053098|sp|Q68RY5.1|RK33_PANGI RecName: Full=50S ribosomal protein L33, chloroplastic gi|51235334|gb|AAT98530.1| ribosomal protein L33 [Panax ginseng] gi|458599111|gb|AGG38977.1| ribosomal protein L33 (chloroplast) [Aralia undulata] gi|458599213|gb|AGG39064.1| ribosomal protein L33 (chloroplast) [Brassaiopsis hainla] gi|458599392|gb|AGG39151.1| ribosomal protein L33 (chloroplast) [Metapanax delavayi] gi|458599545|gb|AGG39238.1| ribosomal protein L33 (chloroplast) [Schefflera delavayi] gi|506444450|gb|AGM15012.1| ribosomal protein L33 (chloroplast) [Panax ginseng] gi|506444538|gb|AGM15098.1| ribosomal protein L33 (chloroplast) [Panax ginseng] gi|506444654|gb|AGM15184.1| ribosomal protein L33 (chloroplast) [Panax ginseng] Length = 66 Score = 106 bits (265), Expect = 5e-21 Identities = 45/66 (68%), Positives = 56/66 (84%) Frame = +3 Query: 183 MAKNKDVRVRIILECTCCPQKADSKISNGISRYTTEKNRHNSPSRVELKKFCPYCNKHTL 362 MAK KDVR+ +ILECT C + +K+S GISRY T+KNRHN+P+R+EL+KFCPYC KHT+ Sbjct: 1 MAKGKDVRITVILECTSCVRNGVNKVSTGISRYITQKNRHNTPNRLELRKFCPYCYKHTI 60 Query: 363 HGEIKK 380 HGEIKK Sbjct: 61 HGEIKK 66