BLASTX nr result
ID: Paeonia23_contig00005823
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00005823 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004166643.1| PREDICTED: ethylene-responsive transcription... 62 1e-07 ref|XP_004144443.1| PREDICTED: ethylene-responsive transcription... 62 1e-07 ref|XP_004303745.1| PREDICTED: ethylene-responsive transcription... 60 2e-07 gb|AAX07458.2| ethylene-responsive element binding protein ERF2 ... 60 4e-07 ref|XP_006297883.1| hypothetical protein CARUB_v10013925mg [Caps... 59 9e-07 gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] 58 2e-06 ref|XP_006407104.1| hypothetical protein EUTSA_v10020945mg [Eutr... 57 3e-06 gb|AAL67489.1|AF459404_1 AP-2 domain containing protein [Narciss... 57 3e-06 gb|AAX20013.1| putative ethylene responsive element binding prot... 56 5e-06 gb|AFG26329.1| ethylene response factor ERF4 [Eriobotrya japonica] 56 6e-06 ref|XP_002885024.1| hypothetical protein ARALYDRAFT_897690 [Arab... 56 6e-06 ref|XP_006305171.1| hypothetical protein CARUB_v10009538mg [Caps... 55 8e-06 ref|XP_004159016.1| PREDICTED: ethylene-responsive transcription... 55 8e-06 ref|XP_004141728.1| PREDICTED: ethylene-responsive transcription... 55 8e-06 gb|AAM65746.1| AP2 domain containing protein, putative [Arabidop... 55 8e-06 ref|NP_175794.1| ethylene-responsive transcription factor RAP2-1... 55 8e-06 ref|XP_006392736.1| hypothetical protein EUTSA_v10011606mg [Eutr... 55 8e-06 ref|XP_002891780.1| hypothetical protein ARALYDRAFT_892441 [Arab... 55 8e-06 gb|ADE41148.1| AP2 domain class transcription factor [Malus dome... 55 8e-06 ref|NP_001077718.1| ethylene-responsive transcription factor RAP... 55 8e-06 >ref|XP_004166643.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Cucumis sativus] Length = 370 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPPSRS RVTADHLWP LK Sbjct: 1 MCGGAIISDFIPPSRSNRVTADHLWPNLK 29 >ref|XP_004144443.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Cucumis sativus] Length = 370 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/29 (93%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPPSRS RVTADHLWP LK Sbjct: 1 MCGGAIISDFIPPSRSNRVTADHLWPNLK 29 >ref|XP_004303745.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Fragaria vesca subsp. vesca] Length = 391 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELKNRXXXXXXXXXXKPIRS 293 MCGGAIIS FIPP+RSRRVTAD LWP+LK +P+RS Sbjct: 1 MCGGAIISGFIPPTRSRRVTADFLWPDLKKSSSGKRFSSGGRPLRS 46 >gb|AAX07458.2| ethylene-responsive element binding protein ERF2 [Gossypium hirsutum] Length = 390 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPPSRSRR+TAD LWP+LK Sbjct: 1 MCGGAIISDFIPPSRSRRLTADFLWPDLK 29 >ref|XP_006297883.1| hypothetical protein CARUB_v10013925mg [Capsella rubella] gi|482566592|gb|EOA30781.1| hypothetical protein CARUB_v10013925mg [Capsella rubella] Length = 385 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELKNR 248 MCGGAIISDFIPP RSRRVT++ +WP+LKN+ Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLKNK 31 >gb|AEK81532.1| ethylene response factor [Ophiopogon japonicus] Length = 348 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP+RSR++TAD+LWP LK Sbjct: 1 MCGGAIISDFIPPARSRKLTADYLWPNLK 29 >ref|XP_006407104.1| hypothetical protein EUTSA_v10020945mg [Eutrema salsugineum] gi|567199340|ref|XP_006407105.1| hypothetical protein EUTSA_v10020945mg [Eutrema salsugineum] gi|312281481|dbj|BAJ33606.1| unnamed protein product [Thellungiella halophila] gi|557108250|gb|ESQ48557.1| hypothetical protein EUTSA_v10020945mg [Eutrema salsugineum] gi|557108251|gb|ESQ48558.1| hypothetical protein EUTSA_v10020945mg [Eutrema salsugineum] Length = 377 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELKNR 248 MCGGAIISDFIPP SRRVT++ LWP+LKN+ Sbjct: 1 MCGGAIISDFIPPPSSRRVTSEFLWPDLKNK 31 >gb|AAL67489.1|AF459404_1 AP-2 domain containing protein [Narcissus pseudonarcissus] Length = 153 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPEL 239 MCGGAIISDFIPPSRSR++TAD+LWP L Sbjct: 1 MCGGAIISDFIPPSRSRKLTADYLWPNL 28 >gb|AAX20013.1| putative ethylene responsive element binding protein [Gossypium hirsutum] Length = 396 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP+RSR VTA++LWP+LK Sbjct: 1 MCGGAIISDFIPPARSRLVTANYLWPDLK 29 >gb|AFG26329.1| ethylene response factor ERF4 [Eriobotrya japonica] Length = 385 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELKNRXXXXXXXXXXKPIRS 293 MCGGAIISDFI P RSRR+TAD+LWP+LK KP+RS Sbjct: 1 MCGGAIISDFIAPVRSRRLTADYLWPDLKK---PSSGKRLSKPLRS 43 >ref|XP_002885024.1| hypothetical protein ARALYDRAFT_897690 [Arabidopsis lyrata subsp. lyrata] gi|297330864|gb|EFH61283.1| hypothetical protein ARALYDRAFT_897690 [Arabidopsis lyrata subsp. lyrata] Length = 384 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELKNR 248 MCGGAIISDFIPP RS RVT++ +WP+LKN+ Sbjct: 1 MCGGAIISDFIPPPRSLRVTSEFIWPDLKNK 31 >ref|XP_006305171.1| hypothetical protein CARUB_v10009538mg [Capsella rubella] gi|482573882|gb|EOA38069.1| hypothetical protein CARUB_v10009538mg [Capsella rubella] Length = 360 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP RSRRVT++ +WP+LK Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLK 29 >ref|XP_004159016.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Cucumis sativus] Length = 389 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIIS FIPP RSRRVT +HLWP LK Sbjct: 1 MCGGAIISGFIPPIRSRRVTGEHLWPNLK 29 >ref|XP_004141728.1| PREDICTED: ethylene-responsive transcription factor RAP2-12-like [Cucumis sativus] Length = 389 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIIS FIPP RSRRVT +HLWP LK Sbjct: 1 MCGGAIISGFIPPIRSRRVTGEHLWPNLK 29 >gb|AAM65746.1| AP2 domain containing protein, putative [Arabidopsis thaliana] Length = 358 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP RSRRVT++ +WP+LK Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLK 29 >ref|NP_175794.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|79319902|ref|NP_001031185.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|75337589|sp|Q9SSA8.1|RA212_ARATH RecName: Full=Ethylene-responsive transcription factor RAP2-12; AltName: Full=Protein RELATED TO APETALA2 12 gi|6056399|gb|AAF02863.1|AC009324_12 AP2 domain containing protein RAP2.12 [Arabidopsis thaliana] gi|14335162|gb|AAK59861.1| At1g53910/T18A20_14 [Arabidopsis thaliana] gi|15982876|gb|AAL09785.1| At1g53910/T18A20_14 [Arabidopsis thaliana] gi|21360487|gb|AAM47359.1| At1g53910/T18A20_14 [Arabidopsis thaliana] gi|222423411|dbj|BAH19677.1| AT1G53910 [Arabidopsis thaliana] gi|332194901|gb|AEE33022.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|332194902|gb|AEE33023.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] Length = 358 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP RSRRVT++ +WP+LK Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLK 29 >ref|XP_006392736.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum] gi|567131585|ref|XP_006392737.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum] gi|567131588|ref|XP_006392738.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum] gi|312282863|dbj|BAJ34297.1| unnamed protein product [Thellungiella halophila] gi|557089314|gb|ESQ30022.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum] gi|557089315|gb|ESQ30023.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum] gi|557089316|gb|ESQ30024.1| hypothetical protein EUTSA_v10011606mg [Eutrema salsugineum] Length = 359 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP RSRRVT++ +WP+LK Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLK 29 >ref|XP_002891780.1| hypothetical protein ARALYDRAFT_892441 [Arabidopsis lyrata subsp. lyrata] gi|297337622|gb|EFH68039.1| hypothetical protein ARALYDRAFT_892441 [Arabidopsis lyrata subsp. lyrata] Length = 345 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP RSRRVT++ +WP+LK Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLK 29 >gb|ADE41148.1| AP2 domain class transcription factor [Malus domestica] Length = 386 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFI P RSRR+TAD+LWP+LK Sbjct: 1 MCGGAIISDFIAPVRSRRLTADYLWPDLK 29 >ref|NP_001077718.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] gi|332194903|gb|AEE33024.1| ethylene-responsive transcription factor RAP2-12 [Arabidopsis thaliana] Length = 356 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = +3 Query: 156 MCGGAIISDFIPPSRSRRVTADHLWPELK 242 MCGGAIISDFIPP RSRRVT++ +WP+LK Sbjct: 1 MCGGAIISDFIPPPRSRRVTSEFIWPDLK 29