BLASTX nr result
ID: Paeonia23_contig00004279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00004279 (774 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309381.2| hypothetical protein POPTR_0006s19150g, part... 50 1e-07 ref|XP_002271279.1| PREDICTED: auxin-induced protein 5NG4-like [... 51 1e-05 >ref|XP_002309381.2| hypothetical protein POPTR_0006s19150g, partial [Populus trichocarpa] gi|550336637|gb|EEE92904.2| hypothetical protein POPTR_0006s19150g, partial [Populus trichocarpa] Length = 212 Score = 49.7 bits (117), Expect(2) = 1e-07 Identities = 19/32 (59%), Positives = 26/32 (81%) Frame = +3 Query: 405 LQDYTVLGSGGENWLIGWLFLFDSSYCWSLWL 500 L + T+ GSGGE+WL+G LF+F S+ CWS+WL Sbjct: 9 LLNKTIFGSGGEDWLLGCLFIFVSTCCWSIWL 40 Score = 33.5 bits (75), Expect(2) = 1e-07 Identities = 13/39 (33%), Positives = 23/39 (58%) Frame = +1 Query: 499 CFAAWMCYMATLQCAITCCPNHIALLAWMCYMATCDNRI 615 C++ W+ L + P+H++L AWMC++AT + I Sbjct: 35 CWSIWLILQVPLTASY---PDHLSLSAWMCFLATLQSGI 70 >ref|XP_002271279.1| PREDICTED: auxin-induced protein 5NG4-like [Vitis vinifera] Length = 506 Score = 50.8 bits (120), Expect(2) = 1e-05 Identities = 20/39 (51%), Positives = 26/39 (66%) Frame = +3 Query: 402 FLQDYTVLGSGGENWLIGWLFLFDSSYCWSLWLFCSMDV 518 FL + GSGG+NWL+G LFLF + CWSLWL + + Sbjct: 299 FLPTKSAFGSGGQNWLLGCLFLFAGTCCWSLWLILQVPI 337 Score = 25.4 bits (54), Expect(2) = 1e-05 Identities = 8/14 (57%), Positives = 12/14 (85%) Frame = +1 Query: 505 AAWMCYMATLQCAI 546 +AWMC+ +TLQ A+ Sbjct: 348 SAWMCFFSTLQSAV 361