BLASTX nr result
ID: Paeonia23_contig00003851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00003851 (353 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK41721.1| unknown [Lotus japonicus] 65 1e-08 ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Gly... 63 5e-08 gb|ACU24145.1| unknown [Glycine max] 63 5e-08 ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-... 62 8e-08 ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago trun... 62 1e-07 ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phas... 60 2e-07 ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-... 60 2e-07 ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-... 60 2e-07 ref|NP_001237443.1| uncharacterized protein LOC100499887 precurs... 60 4e-07 gb|AFK34375.1| unknown [Medicago truncatula] 59 5e-07 gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasi... 59 5e-07 ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trich... 59 7e-07 gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] 57 2e-06 ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prun... 57 2e-06 ref|XP_002525552.1| cysteine protease inhibitor, putative [Ricin... 57 2e-06 emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis] 57 2e-06 gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] 57 4e-06 ref|XP_006644042.1| PREDICTED: cysteine proteinase inhibitor 12-... 55 8e-06 dbj|BAD81175.1| putative cysteine proteinase inhibitor [Oryza sa... 55 8e-06 ref|NP_001042702.1| Os01g0270100 [Oryza sativa Japonica Group] g... 55 8e-06 >gb|AFK41721.1| unknown [Lotus japonicus] Length = 237 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/43 (72%), Positives = 37/43 (86%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VIDDVAKF + LKL+RG KEEKF V V+KN++G F+LNQMEQD Sbjct: 193 VIDDVAKFNILLKLKRGEKEEKFKVEVHKNNEGSFHLNQMEQD 235 >ref|NP_001237734.1| cysteine proteinase inhibitor precursor [Glycine max] gi|1944319|dbj|BAA19608.1| cysteine proteinase inhibitor [Glycine max] gi|1944342|dbj|BAA19610.1| cysteine proteinase inhibitor [Glycine max] Length = 245 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VIDD AKF + LK++RG KEEKF V V+KN+QG F+LNQMEQD Sbjct: 201 VIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQD 243 >gb|ACU24145.1| unknown [Glycine max] Length = 245 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VIDD AKF + LK++RG KEEKF V V+KN+QG F+LNQMEQD Sbjct: 201 VIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQGGFHLNQMEQD 243 >ref|XP_004511090.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cicer arietinum] Length = 247 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VIDDVA F + LKL+RG+KEEKF V V+KN++G F+LNQME D Sbjct: 203 VIDDVANFNLLLKLKRGAKEEKFKVEVHKNNEGTFHLNQMEAD 245 >ref|XP_003628013.1| Cysteine proteinase inhibitor [Medicago truncatula] gi|355522035|gb|AET02489.1| Cysteine proteinase inhibitor [Medicago truncatula] Length = 241 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQDD 134 VIDD AKF + LK++RG KEEKF V V+KNS+G F+LNQME D+ Sbjct: 197 VIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSEGNFHLNQMEADN 240 >ref|XP_007133641.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] gi|561006641|gb|ESW05635.1| hypothetical protein PHAVU_011G196600g [Phaseolus vulgaris] Length = 246 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 V+DD AKF + LK++RG KEEKF V V+KN+QG +LNQMEQD Sbjct: 202 VVDDFAKFNLLLKVKRGEKEEKFKVEVHKNNQGELHLNQMEQD 244 >ref|XP_004165517.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 202 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VI+D AKF++ LKL+RGSKEEKF V V+KN++G F LNQM QD Sbjct: 158 VIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQD 200 >ref|XP_004147084.1| PREDICTED: cysteine proteinase inhibitor 12-like [Cucumis sativus] Length = 249 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VI+D AKF++ LKL+RGSKEEKF V V+KN++G F LNQM QD Sbjct: 205 VIEDAAKFDLLLKLKRGSKEEKFKVEVHKNNEGNFLLNQMVQD 247 >ref|NP_001237443.1| uncharacterized protein LOC100499887 precursor [Glycine max] gi|255627437|gb|ACU14063.1| unknown [Glycine max] Length = 245 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VIDD AKF + LK++RG KEEKF V V+KN+Q F+LNQMEQD Sbjct: 201 VIDDFAKFNLLLKVKRGQKEEKFKVEVHKNNQRGFHLNQMEQD 243 >gb|AFK34375.1| unknown [Medicago truncatula] Length = 241 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQDD 134 VIDD AKF + LK++RG KEEKF V V+KNS+ F+LNQME D+ Sbjct: 197 VIDDTAKFNLLLKVKRGQKEEKFKVEVHKNSESNFHLNQMEADN 240 >gb|AAM88397.1|AF525880_1 cysteine proteinase inhibitor [Colocasia esculenta] Length = 205 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/43 (62%), Positives = 36/43 (83%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 V++D+AK + LKL+RGS+EEKF V V+KN +G F+LNQMEQD Sbjct: 157 VLEDLAKIHLLLKLKRGSREEKFKVEVHKNIEGTFHLNQMEQD 199 >ref|XP_002303955.1| cysteine proteinase inhibitor [Populus trichocarpa] gi|222841387|gb|EEE78934.1| cysteine proteinase inhibitor [Populus trichocarpa] Length = 235 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQME 125 V+DD AKF+M LK++RGS EEKF V+V+KN++G ++LNQME Sbjct: 192 VVDDSAKFDMLLKVKRGSTEEKFKVLVHKNNEGNYHLNQME 232 >gb|EXB62705.1| Cysteine proteinase inhibitor 12 [Morus notabilis] Length = 239 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/43 (60%), Positives = 36/43 (83%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VID+ AKF+M LK++RG+KEEK+ V+KNS+G F+LNQ+E D Sbjct: 195 VIDNSAKFDMILKVKRGTKEEKYKAEVHKNSEGTFHLNQIEPD 237 >ref|XP_007220532.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] gi|462416994|gb|EMJ21731.1| hypothetical protein PRUPE_ppa010412mg [Prunus persica] Length = 250 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 VI++ AKF M LKL+RG KEEKF V V+KN++G F LNQME D Sbjct: 206 VIEEHAKFNMLLKLKRGDKEEKFKVEVHKNNEGTFKLNQMEAD 248 >ref|XP_002525552.1| cysteine protease inhibitor, putative [Ricinus communis] gi|223535131|gb|EEF36811.1| cysteine protease inhibitor, putative [Ricinus communis] Length = 238 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQME 125 V+DD AKF+M LK++RG+ EEKF V V+KN++G F LNQME Sbjct: 195 VVDDFAKFDMILKVKRGTSEEKFKVEVHKNNEGTFLLNQME 235 >emb|CAA89697.1| cysteine proteinase inhibitor [Ricinus communis] Length = 209 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQME 125 V+DD AKF+M LK++RG+ EEKF V V+KN++G F LNQME Sbjct: 166 VVDDFAKFDMILKVKRGTSEEKFKVEVHKNNEGTFLLNQME 206 >gb|AHA85335.1| cysteine protease inhibitor [Curcuma longa] Length = 228 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/44 (59%), Positives = 36/44 (81%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQDD 134 VI++ AKF+M LK++RGSKEEKF V+KN +G F LNQM+Q++ Sbjct: 185 VIEETAKFDMLLKVKRGSKEEKFKAEVHKNLEGNFLLNQMQQEN 228 >ref|XP_006644042.1| PREDICTED: cysteine proteinase inhibitor 12-like [Oryza brachyantha] Length = 250 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 V++D AKF++ +KL+RG+KEEKF V+KN +G F LNQM+Q+ Sbjct: 201 VVEDFAKFDILMKLKRGTKEEKFKAEVHKNLEGAFVLNQMQQE 243 >dbj|BAD81175.1| putative cysteine proteinase inhibitor [Oryza sativa Japonica Group] gi|222618172|gb|EEE54304.1| hypothetical protein OsJ_01243 [Oryza sativa Japonica Group] Length = 208 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 V++D AKF++ +KL+RG+KEEKF V+KN +G F LNQM+Q+ Sbjct: 159 VVEDFAKFDILMKLKRGNKEEKFKAEVHKNLEGAFVLNQMQQE 201 >ref|NP_001042702.1| Os01g0270100 [Oryza sativa Japonica Group] gi|122228720|sp|Q0JNR2.1|CYT12_ORYSJ RecName: Full=Cysteine proteinase inhibitor 12; AltName: Full=Oryzacystatin XII; Short=OC-XII; AltName: Full=Oryzacystatin-12; Flags: Precursor gi|113532233|dbj|BAF04616.1| Os01g0270100 [Oryza sativa Japonica Group] gi|215767437|dbj|BAG99665.1| unnamed protein product [Oryza sativa Japonica Group] Length = 250 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/43 (55%), Positives = 35/43 (81%) Frame = +3 Query: 3 VIDDVAKFEMSLKLRRGSKEEKFMVIVNKNSQGLFYLNQMEQD 131 V++D AKF++ +KL+RG+KEEKF V+KN +G F LNQM+Q+ Sbjct: 201 VVEDFAKFDILMKLKRGNKEEKFKAEVHKNLEGAFVLNQMQQE 243