BLASTX nr result
ID: Paeonia23_contig00003607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00003607 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protei... 66 4e-09 ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-l... 65 1e-08 ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-l... 65 1e-08 gb|AFK46889.1| unknown [Medicago truncatula] 65 1e-08 gb|AFK38760.1| unknown [Lotus japonicus] 65 1e-08 ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago tr... 65 1e-08 emb|CBI25508.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [... 65 1e-08 emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera] 65 1e-08 emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera] 65 1e-08 ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutr... 64 2e-08 ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phas... 64 3e-08 emb|CBI31491.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [... 64 3e-08 ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-l... 63 4e-08 ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus t... 63 4e-08 gb|ABK95701.1| unknown [Populus trichocarpa] 63 4e-08 ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0-1... 63 5e-08 ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0-1... 63 5e-08 ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-1... 63 5e-08 >sp|P50345.1|RLA0_LUPLU RecName: Full=60S acidic ribosomal protein P0 gi|1143507|emb|CAA63786.1| P0 ribosomal protein [Lupinus luteus] Length = 322 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFPQADEVKE+LKDPSKF Sbjct: 246 NAYKNVLAVAVATEYSFPQADEVKEYLKDPSKF 278 >ref|XP_004490967.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum] Length = 321 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFP+AD+VKEFLKDPSKF Sbjct: 246 NAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF 278 >ref|XP_004490966.1| PREDICTED: 60S acidic ribosomal protein P0-like [Cicer arietinum] Length = 321 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFP+AD+VKEFLKDPSKF Sbjct: 246 NAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF 278 >gb|AFK46889.1| unknown [Medicago truncatula] Length = 323 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFP+AD+VKEFLKDPSKF Sbjct: 246 NAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF 278 >gb|AFK38760.1| unknown [Lotus japonicus] Length = 322 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKN+LAVA+A+EYSFPQADEVKE+LKDPSKF Sbjct: 245 NAYKNILAVALATEYSFPQADEVKEYLKDPSKF 277 >ref|XP_003616595.1| 60S acidic ribosomal protein p0 [Medicago truncatula] gi|355517930|gb|AES99553.1| 60S acidic ribosomal protein p0 [Medicago truncatula] Length = 323 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFP+AD+VKEFLKDPSKF Sbjct: 246 NAYKNVLAVAVATEYSFPEADKVKEFLKDPSKF 278 >emb|CBI25508.3| unnamed protein product [Vitis vinifera] Length = 292 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFPQAD+VKE+LKDPSKF Sbjct: 218 NAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF 250 >ref|XP_002268645.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera] Length = 320 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFPQAD+VKE+LKDPSKF Sbjct: 246 NAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF 278 >emb|CAN80537.1| hypothetical protein VITISV_003812 [Vitis vinifera] Length = 320 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVL+VAVA+EYSFPQAD+VKEFLKDPSKF Sbjct: 246 NAYKNVLSVAVATEYSFPQADKVKEFLKDPSKF 278 >emb|CAN76468.1| hypothetical protein VITISV_030042 [Vitis vinifera] Length = 303 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+EYSFPQAD+VKE+LKDPSKF Sbjct: 229 NAYKNVLAVAVATEYSFPQADKVKEYLKDPSKF 261 >ref|XP_006411245.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum] gi|557112414|gb|ESQ52698.1| hypothetical protein EUTSA_v10016954mg [Eutrema salsugineum] Length = 317 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLA+A+A+EYSFPQAD VKEFLKDPSKF Sbjct: 246 NAYKNVLAIALATEYSFPQADNVKEFLKDPSKF 278 >ref|XP_007163525.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris] gi|561036989|gb|ESW35519.1| hypothetical protein PHAVU_001G241400g [Phaseolus vulgaris] Length = 317 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 N+YKNVLAVAV +EYSFP+ADEVKEFLKDPSKF Sbjct: 246 NSYKNVLAVAVVTEYSFPEADEVKEFLKDPSKF 278 >emb|CBI31491.3| unnamed protein product [Vitis vinifera] Length = 292 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVL+VAVA++YSFPQAD+VKEFLKDPSKF Sbjct: 218 NAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF 250 >ref|XP_002276842.1| PREDICTED: 60S acidic ribosomal protein P0 [Vitis vinifera] Length = 320 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVL+VAVA++YSFPQAD+VKEFLKDPSKF Sbjct: 246 NAYKNVLSVAVATDYSFPQADKVKEFLKDPSKF 278 >ref|XP_004296403.1| PREDICTED: 60S acidic ribosomal protein P0-like [Fragaria vesca subsp. vesca] Length = 319 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLAVAVA+E+SFPQAD+VKE+LKDPSKF Sbjct: 245 NAYKNVLAVAVATEFSFPQADKVKEYLKDPSKF 277 >ref|XP_002312149.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa] gi|222851969|gb|EEE89516.1| 60S acidic ribosomal protein P0-A [Populus trichocarpa] Length = 322 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKN+L+VAVA+EYS+PQA+EVKEFLKDPSKF Sbjct: 246 NAYKNILSVAVATEYSYPQAEEVKEFLKDPSKF 278 >gb|ABK95701.1| unknown [Populus trichocarpa] Length = 322 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKN+L+VAVA+EYS+PQA+EVKEFLKDPSKF Sbjct: 246 NAYKNILSVAVATEYSYPQAEEVKEFLKDPSKF 278 >ref|XP_004307662.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca subsp. vesca] Length = 321 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLA+AVA+EYSFPQAD+VKE+L+DPSKF Sbjct: 245 NAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF 277 >ref|XP_004307622.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca subsp. vesca] Length = 321 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLA+AVA+EYSFPQAD+VKE+L+DPSKF Sbjct: 245 NAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF 277 >ref|XP_004287422.1| PREDICTED: 60S acidic ribosomal protein P0-1-like [Fragaria vesca subsp. vesca] Length = 321 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 386 NAYKNVLAVAVASEYSFPQADEVKEFLKDPSKF 288 NAYKNVLA+AVA+EYSFPQAD+VKE+L+DPSKF Sbjct: 245 NAYKNVLAIAVATEYSFPQADKVKEYLEDPSKF 277