BLASTX nr result
ID: Paeonia23_contig00002982
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00002982 (299 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_006125474.1| conserved hypothetical protein, partial [Str... 174 9e-42 ref|WP_024263321.1| hypothetical protein [Streptomyces filamento... 174 2e-41 ref|WP_005320117.1| hypothetical protein [Streptomyces pristinae... 168 6e-40 ref|WP_005315412.1| hypothetical protein [Streptomyces pristinae... 168 6e-40 ref|WP_009716045.1| conserved hypothetical protein, partial [Str... 165 5e-39 ref|WP_009068221.1| hypothetical protein [Streptomyces sp. SPB78... 164 2e-38 ref|WP_007265423.1| hypothetical protein [Streptomyces] gi|19434... 162 3e-38 ref|WP_008749163.1| hypothetical protein [Streptomyces sp. SPB74... 162 5e-38 ref|WP_003951215.1| conserved hypothetical protein, partial [Str... 162 6e-38 ref|WP_007381066.1| hypothetical protein [Streptomyces sviceus] ... 161 8e-38 ref|WP_003948855.1| hypothetical protein [Streptomyces albus] gi... 161 8e-38 ref|WP_003953578.1| hypothetical protein [Streptomyces clavulige... 161 1e-37 ref|WP_009189403.1| hypothetical protein [Streptomyces sp. e14] ... 160 2e-37 ref|WP_005311169.1| conserved hypothetical protein, partial [Str... 152 4e-35 ref|WP_004990860.1| conserved hypothetical protein, partial [Str... 137 2e-30 ref|WP_002542278.1| hypothetical protein [Propionibacterium acne... 119 2e-27 ref|WP_003789862.1| hypothetical protein [Actinomyces odontolyti... 117 1e-24 ref|WP_006235594.1| hypothetical protein [Collinsella aerofacien... 105 1e-21 ref|WP_006235727.1| hypothetical protein [Collinsella aerofacien... 100 4e-20 ref|YP_001680918.1| hypothetical protein HM1_3149 [Heliobacteriu... 96 1e-18 >ref|WP_006125474.1| conserved hypothetical protein, partial [Streptomyces filamentosus] gi|291348568|gb|EFE75472.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 15998] Length = 96 Score = 174 bits (442), Expect = 9e-42 Identities = 83/84 (98%), Positives = 83/84 (98%) Frame = +3 Query: 3 ATSATLVLCCQHALRGDGDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCRE 182 ATSATLVLCCQHALR DGDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCRE Sbjct: 3 ATSATLVLCCQHALRRDGDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCRE 62 Query: 183 AERISKSRSQFGLGSATRPHEVGV 254 AERISKSRSQFGLGSATRPHEVGV Sbjct: 63 AERISKSRSQFGLGSATRPHEVGV 86 >ref|WP_024263321.1| hypothetical protein [Streptomyces filamentosus] gi|586913541|gb|EWS90747.1| hypothetical protein SSIG_01113 [Streptomyces roseosporus NRRL 11379] Length = 95 Score = 174 bits (440), Expect = 2e-41 Identities = 82/82 (100%), Positives = 82/82 (100%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSELLVIADQHCCGEYVP Sbjct: 61 LDPMKSELLVIADQHCCGEYVP 82 >ref|WP_005320117.1| hypothetical protein [Streptomyces pristinaespiralis] gi|297152875|gb|EFH32042.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 121 Score = 168 bits (426), Expect = 6e-40 Identities = 79/82 (96%), Positives = 80/82 (97%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGT SC+A RRSESQKAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSELLVIADQHCCGEYVP Sbjct: 61 LDPMKSELLVIADQHCCGEYVP 82 >ref|WP_005315412.1| hypothetical protein [Streptomyces pristinaespiralis] gi|297151805|gb|EDY62143.2| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 95 Score = 168 bits (426), Expect = 6e-40 Identities = 79/82 (96%), Positives = 80/82 (97%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGT SC+A RRSESQKAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSELLVIADQHCCGEYVP Sbjct: 61 LDPMKSELLVIADQHCCGEYVP 82 >ref|WP_009716045.1| conserved hypothetical protein, partial [Streptomyces himastatinicus] gi|302461143|gb|EFL24236.1| conserved hypothetical protein [Streptomyces himastatinicus ATCC 53653] Length = 84 Score = 165 bits (418), Expect = 5e-39 Identities = 78/82 (95%), Positives = 79/82 (96%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSC+A R SESQKAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCEAVRWSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMK ELLVIADQHCCGEYVP Sbjct: 61 LDPMKLELLVIADQHCCGEYVP 82 >ref|WP_009068221.1| hypothetical protein [Streptomyces sp. SPB78] gi|302430311|gb|EFL02127.1| conserved hypothetical protein [Streptomyces sp. SPB78] Length = 121 Score = 164 bits (414), Expect = 2e-38 Identities = 78/82 (95%), Positives = 78/82 (95%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTH R PGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCD AR SESQKAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSELLVIADQHCCGEYVP Sbjct: 61 LDPMKSELLVIADQHCCGEYVP 82 >ref|WP_007265423.1| hypothetical protein [Streptomyces] gi|194341437|gb|EDX22403.1| conserved hypothetical protein [Streptomyces sp. Mg1] gi|302444665|gb|EFL16481.1| conserved hypothetical protein [Streptomyces sp. C] Length = 95 Score = 162 bits (411), Expect = 3e-38 Identities = 77/82 (93%), Positives = 77/82 (93%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRR PGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCD R SESQKAGLSSDWGLQ Sbjct: 1 MGTHRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSE LVIADQHCCGEYVP Sbjct: 61 LDPMKSESLVIADQHCCGEYVP 82 >ref|WP_008749163.1| hypothetical protein [Streptomyces sp. SPB74] gi|295827790|gb|EDY45007.2| conserved hypothetical protein [Streptomyces sp. SPB74] Length = 95 Score = 162 bits (410), Expect = 5e-38 Identities = 77/82 (93%), Positives = 77/82 (93%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTH R PGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCD R SESQKAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSELLVIADQHCCGEYVP Sbjct: 61 LDPMKSELLVIADQHCCGEYVP 82 >ref|WP_003951215.1| conserved hypothetical protein, partial [Streptomyces albus] gi|291357453|gb|EFE84355.1| conserved hypothetical protein [Streptomyces albus J1074] Length = 87 Score = 162 bits (409), Expect = 6e-38 Identities = 77/83 (92%), Positives = 78/83 (93%) Frame = +1 Query: 49 VMGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGL 228 V+GTH R PGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCD AR SESQKAGLSSDWGL Sbjct: 4 VLGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGL 63 Query: 229 QLDPMKSELLVIADQHCCGEYVP 297 QLDPMKSE LVIADQHCCGEYVP Sbjct: 64 QLDPMKSESLVIADQHCCGEYVP 86 >ref|WP_007381066.1| hypothetical protein [Streptomyces sviceus] gi|297147182|gb|EFH28520.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083] Length = 137 Score = 161 bits (408), Expect = 8e-38 Identities = 77/82 (93%), Positives = 77/82 (93%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRR PGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCD R SESQKA LSSDWGLQ Sbjct: 1 MGTHRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKACLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSELLVIADQHCCGEYVP Sbjct: 61 LDPMKSELLVIADQHCCGEYVP 82 >ref|WP_003948855.1| hypothetical protein [Streptomyces albus] gi|291355076|gb|EFE81978.1| conserved hypothetical protein [Streptomyces albus J1074] Length = 121 Score = 161 bits (408), Expect = 8e-38 Identities = 77/82 (93%), Positives = 77/82 (93%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTH R PGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCD AR SESQKAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSE LVIADQHCCGEYVP Sbjct: 61 LDPMKSESLVIADQHCCGEYVP 82 >ref|WP_003953578.1| hypothetical protein [Streptomyces clavuligerus] gi|197702336|gb|EDY48148.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 27064] Length = 95 Score = 161 bits (407), Expect = 1e-37 Identities = 76/82 (92%), Positives = 77/82 (93%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRR PGSTRRKVGTTSSHHAPYVLGCTRATMAGT SC+ R SESQKAGLSSDWGLQ Sbjct: 1 MGTHRRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSELLVIADQHCCGEYVP Sbjct: 61 LDPMKSELLVIADQHCCGEYVP 82 >ref|WP_009189403.1| hypothetical protein [Streptomyces sp. e14] gi|292833485|gb|EFF91834.1| conserved hypothetical protein [Streptomyces sp. e14] Length = 95 Score = 160 bits (404), Expect = 2e-37 Identities = 76/82 (92%), Positives = 76/82 (92%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTH R PGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCD R SESQKAGLSSDWGLQ Sbjct: 1 MGTHGRPPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCCGEYVP 297 LDPMKSE LVIADQHCCGEYVP Sbjct: 61 LDPMKSESLVIADQHCCGEYVP 82 >ref|WP_005311169.1| conserved hypothetical protein, partial [Streptomyces pristinaespiralis] gi|297151021|gb|EFH30930.1| conserved hypothetical protein [Streptomyces pristinaespiralis ATCC 25486] Length = 88 Score = 152 bits (385), Expect = 4e-35 Identities = 73/77 (94%), Positives = 74/77 (96%) Frame = +1 Query: 52 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQ 231 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGT SC+A RRSESQKAGLSSDWGLQ Sbjct: 1 MGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQ 60 Query: 232 LDPMKSELLVIADQHCC 282 LDPMKSELLVIADQH C Sbjct: 61 LDPMKSELLVIADQHGC 77 >ref|WP_004990860.1| conserved hypothetical protein, partial [Streptomyces ghanaensis] gi|291343775|gb|EFE70731.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces ghanaensis ATCC 14672] Length = 134 Score = 137 bits (345), Expect = 2e-30 Identities = 65/69 (94%), Positives = 66/69 (95%) Frame = +3 Query: 48 GDGDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCREAERISKSRSQFGLGS 227 G GDS+ETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELR RE ERISKSRSQFGLGS Sbjct: 10 GAGDSRETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRYREVERISKSRSQFGLGS 69 Query: 228 ATRPHEVGV 254 ATRPHEVGV Sbjct: 70 ATRPHEVGV 78 >ref|WP_002542278.1| hypothetical protein [Propionibacterium acnes] gi|313773062|gb|EFS39028.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes HL074PA1] Length = 105 Score = 119 bits (298), Expect(2) = 2e-27 Identities = 59/76 (77%), Positives = 60/76 (78%) Frame = +3 Query: 27 CCQHALRGDGDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCREAERISKSR 206 C R GDS ETAGVNSEEGGDDVKSSCPLC GLH CYNG Y E R E ERIS+SR Sbjct: 20 CSLLPARYGGDSVETAGVNSEEGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESR 79 Query: 207 SQFGLGSATRPHEVGV 254 SQFGLGSATRPHEVGV Sbjct: 80 SQFGLGSATRPHEVGV 95 Score = 28.9 bits (63), Expect(2) = 2e-27 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +2 Query: 2 RNERNPCSVLPA 37 RNERNPCS+LPA Sbjct: 14 RNERNPCSLLPA 25 >ref|WP_003789862.1| hypothetical protein [Actinomyces odontolyticus] gi|153799348|gb|EDN81768.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus ATCC 17982] Length = 89 Score = 117 bits (294), Expect = 1e-24 Identities = 58/75 (77%), Positives = 60/75 (80%) Frame = +1 Query: 70 LPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQLDPMKS 249 +PG TRRKVG TS+HHAPYVLG T ATMAGT CD R SES KA LSSDWGLQLDPMK Sbjct: 1 MPGLTRRKVGMTSNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKV 60 Query: 250 ELLVIADQHCCGEYV 294 E LVIADQ CGEYV Sbjct: 61 ESLVIADQQRCGEYV 75 >ref|WP_006235594.1| hypothetical protein [Collinsella aerofaciens] gi|133774810|gb|EBA38630.1| hypothetical protein COLAER_02284 [Collinsella aerofaciens ATCC 25986] gi|133775023|gb|EBA38843.1| hypothetical protein COLAER_01925 [Collinsella aerofaciens ATCC 25986] gi|133775241|gb|EBA39061.1| hypothetical protein COLAER_01671 [Collinsella aerofaciens ATCC 25986] Length = 160 Score = 105 bits (262), Expect(2) = 1e-21 Identities = 49/67 (73%), Positives = 55/67 (82%) Frame = +3 Query: 54 GDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCREAERISKSRSQFGLGSAT 233 G+ + TA V +EEGGDDVKSSCPLC GLHTCYNGRY + RE ERI +SR QFGLG+AT Sbjct: 48 GNPRGTAAVKAEEGGDDVKSSCPLCPGLHTCYNGRYRGMPPREGERIPESRPQFGLGAAT 107 Query: 234 RPHEVGV 254 RPHEVGV Sbjct: 108 RPHEVGV 114 Score = 23.5 bits (49), Expect(2) = 1e-21 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 2 RNERNPCSVLPACPSG 49 RNERNP VLP+ +G Sbjct: 33 RNERNPRRVLPSGDAG 48 >ref|WP_006235727.1| hypothetical protein [Collinsella aerofaciens] gi|133775367|gb|EBA39187.1| hypothetical protein COLAER_01802 [Collinsella aerofaciens ATCC 25986] Length = 115 Score = 100 bits (248), Expect(2) = 4e-20 Identities = 46/64 (71%), Positives = 52/64 (81%) Frame = +3 Query: 54 GDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCREAERISKSRSQFGLGSAT 233 G+ + TA V +EEGGDDVKSSCPLC GLHTCYNGRY + RE ERI +SR QFGLG+AT Sbjct: 48 GNPRGTAAVKAEEGGDDVKSSCPLCPGLHTCYNGRYRGMPPREGERIPESRPQFGLGAAT 107 Query: 234 RPHE 245 RPHE Sbjct: 108 RPHE 111 Score = 23.5 bits (49), Expect(2) = 4e-20 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 2 RNERNPCSVLPACPSG 49 RNERNP VLP+ +G Sbjct: 33 RNERNPRRVLPSGDAG 48 >ref|YP_001680918.1| hypothetical protein HM1_3149 [Heliobacterium modesticaldum Ice1] gi|501240386|ref|WP_012283404.1| hypothetical protein [Heliobacterium modesticaldum] gi|167593159|gb|ABZ84907.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1] Length = 164 Score = 96.3 bits (238), Expect(2) = 1e-18 Identities = 51/80 (63%), Positives = 58/80 (72%) Frame = +1 Query: 37 MPFGVMGTHRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSS 216 +P GT RLPG+T RK G TS+HHAPYVLG TRATM GT +AARRSE +KA SS Sbjct: 38 LPARETGTLGRLPGTTGRKAGMTSNHHAPYVLGYTRATMGGTNRGEAARRSEPEKAAHSS 97 Query: 217 DWGLQLDPMKSELLVIADQH 276 D LQL+ MK+E LVIA QH Sbjct: 98 DCSLQLESMKAESLVIAGQH 117 Score = 22.7 bits (47), Expect(2) = 1e-18 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +2 Query: 2 RNERNPCSVLPACPSG 49 RNERNP LPA +G Sbjct: 29 RNERNPYPQLPARETG 44