BLASTX nr result
ID: Paeonia23_contig00002881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00002881 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007204619.1| hypothetical protein PRUPE_ppa002352mg [Prun... 70 4e-10 ref|XP_006349344.1| PREDICTED: ribosome biogenesis protein BOP1 ... 69 7e-10 ref|XP_004230463.1| PREDICTED: ribosome biogenesis protein BOP1 ... 69 7e-10 gb|EXB29030.1| Ribosome biogenesis protein BOP1-like protein [Mo... 69 9e-10 ref|XP_006494367.1| PREDICTED: ribosome biogenesis protein BOP1 ... 69 9e-10 ref|XP_006431717.1| hypothetical protein CICLE_v10000416mg [Citr... 69 9e-10 ref|XP_006385019.1| hypothetical protein POPTR_0004s23120g [Popu... 67 2e-09 ref|XP_006389551.1| hypothetical protein POPTR_0022s00810g [Popu... 67 2e-09 ref|XP_007206811.1| hypothetical protein PRUPE_ppa025844mg [Prun... 67 3e-09 ref|XP_004141526.1| PREDICTED: ribosome biogenesis protein BOP1 ... 66 6e-09 ref|XP_002885860.1| predicted protein [Arabidopsis lyrata subsp.... 66 6e-09 ref|XP_002529002.1| ribosome biogenesis protein bop1, putative [... 66 6e-09 gb|AAU04772.1| WD40 [Cucumis melo] 66 6e-09 ref|XP_007148552.1| hypothetical protein PHAVU_006G218200g [Phas... 65 8e-09 ref|XP_006397692.1| hypothetical protein EUTSA_v10001320mg [Eutr... 65 8e-09 gb|EPS67648.1| hypothetical protein M569_07123, partial [Genlise... 64 2e-08 dbj|BAE71307.1| putative WD-40 repeat protein [Trifolium pratense] 64 2e-08 ref|XP_003548639.1| PREDICTED: ribosome biogenesis protein BOP1 ... 64 2e-08 ref|XP_003540150.1| PREDICTED: ribosome biogenesis protein BOP1 ... 64 2e-08 ref|XP_003592946.1| Ribosome biogenesis protein bop1 [Medicago t... 64 2e-08 >ref|XP_007204619.1| hypothetical protein PRUPE_ppa002352mg [Prunus persica] gi|462400150|gb|EMJ05818.1| hypothetical protein PRUPE_ppa002352mg [Prunus persica] Length = 683 Score = 69.7 bits (169), Expect = 4e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 STNGRGVMDCKFHPR PWLFTAGADSV++LY H Sbjct: 651 STNGRGVMDCKFHPRQPWLFTAGADSVVRLYCH 683 >ref|XP_006349344.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Solanum tuberosum] Length = 752 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S NGRGVMDCKFHPR PWLFTAGADSVIKLY H Sbjct: 720 SENGRGVMDCKFHPRQPWLFTAGADSVIKLYCH 752 >ref|XP_004230463.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Solanum lycopersicum] Length = 757 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/33 (90%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S NGRGVMDCKFHPR PWLFTAGADSVIKLY H Sbjct: 725 SENGRGVMDCKFHPRQPWLFTAGADSVIKLYCH 757 >gb|EXB29030.1| Ribosome biogenesis protein BOP1-like protein [Morus notabilis] Length = 793 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NGRGVMDCKFHPR PWLFTAGADS+IKLY H Sbjct: 761 SSNGRGVMDCKFHPRQPWLFTAGADSLIKLYCH 793 >ref|XP_006494367.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Citrus sinensis] Length = 727 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NGRGVMDCKFHPR PWLFTAGADSVI+LY H Sbjct: 695 SSNGRGVMDCKFHPRQPWLFTAGADSVIRLYCH 727 >ref|XP_006431717.1| hypothetical protein CICLE_v10000416mg [Citrus clementina] gi|557533839|gb|ESR44957.1| hypothetical protein CICLE_v10000416mg [Citrus clementina] Length = 727 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NGRGVMDCKFHPR PWLFTAGADSVI+LY H Sbjct: 695 SSNGRGVMDCKFHPRQPWLFTAGADSVIRLYCH 727 >ref|XP_006385019.1| hypothetical protein POPTR_0004s23120g [Populus trichocarpa] gi|550341787|gb|ERP62816.1| hypothetical protein POPTR_0004s23120g [Populus trichocarpa] Length = 724 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NGRGV+DCKFHPR PWLFTAGADS+IKLY H Sbjct: 692 SSNGRGVLDCKFHPRQPWLFTAGADSLIKLYCH 724 >ref|XP_006389551.1| hypothetical protein POPTR_0022s00810g [Populus trichocarpa] gi|550312374|gb|ERP48465.1| hypothetical protein POPTR_0022s00810g [Populus trichocarpa] Length = 569 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NGRGV+DCKFHPR PWLFTAGADS+IKLY H Sbjct: 537 SSNGRGVLDCKFHPRQPWLFTAGADSLIKLYCH 569 >ref|XP_007206811.1| hypothetical protein PRUPE_ppa025844mg [Prunus persica] gi|462402453|gb|EMJ08010.1| hypothetical protein PRUPE_ppa025844mg [Prunus persica] Length = 630 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 STN RGVMDCKFHPR PWLFTAGADSV++LY H Sbjct: 598 STNERGVMDCKFHPRQPWLFTAGADSVVRLYCH 630 >ref|XP_004141526.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Cucumis sativus] gi|449517291|ref|XP_004165679.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Cucumis sativus] Length = 724 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 + NGRGVMDCKFHP PWLFTAGADSVIKLY H Sbjct: 692 TVNGRGVMDCKFHPMQPWLFTAGADSVIKLYCH 724 >ref|XP_002885860.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297331700|gb|EFH62119.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 839 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NG GV+DCKFHPR PWLFTAGADSVIKLY H Sbjct: 807 SSNGGGVLDCKFHPRQPWLFTAGADSVIKLYCH 839 >ref|XP_002529002.1| ribosome biogenesis protein bop1, putative [Ricinus communis] gi|223531542|gb|EEF33372.1| ribosome biogenesis protein bop1, putative [Ricinus communis] Length = 735 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NGRG +DCKFHPR PWLFTAGADS+IKLY H Sbjct: 703 SSNGRGTLDCKFHPRQPWLFTAGADSLIKLYCH 735 >gb|AAU04772.1| WD40 [Cucumis melo] Length = 722 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 + NGRGVMDCKFHP PWLFTAGADSVIKLY H Sbjct: 690 NVNGRGVMDCKFHPMQPWLFTAGADSVIKLYCH 722 >ref|XP_007148552.1| hypothetical protein PHAVU_006G218200g [Phaseolus vulgaris] gi|561021775|gb|ESW20546.1| hypothetical protein PHAVU_006G218200g [Phaseolus vulgaris] Length = 732 Score = 65.5 bits (158), Expect = 8e-09 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NGRG++DCKFHPR PWLFTAGAD +IKLY H Sbjct: 700 SSNGRGILDCKFHPRQPWLFTAGADKLIKLYCH 732 >ref|XP_006397692.1| hypothetical protein EUTSA_v10001320mg [Eutrema salsugineum] gi|557098765|gb|ESQ39145.1| hypothetical protein EUTSA_v10001320mg [Eutrema salsugineum] Length = 774 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 S+NG GV+DCKFHPR PWLFTAGADS+IKLY H Sbjct: 742 SSNGGGVLDCKFHPRQPWLFTAGADSIIKLYCH 774 >gb|EPS67648.1| hypothetical protein M569_07123, partial [Genlisea aurea] Length = 600 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 5 TNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 TNGRGV+DC+FHPR PWLFTAGADS+++LY H Sbjct: 569 TNGRGVLDCEFHPRQPWLFTAGADSLVRLYCH 600 >dbj|BAE71307.1| putative WD-40 repeat protein [Trifolium pratense] Length = 738 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 ++NGRG++DCKFHPR PWLFTAGAD +IKLY H Sbjct: 705 NSNGRGILDCKFHPRQPWLFTAGADKLIKLYCH 737 >ref|XP_003548639.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Glycine max] Length = 718 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 ++NGRG++DCKFHPR PWLFTAGAD +IKLY H Sbjct: 686 NSNGRGILDCKFHPRQPWLFTAGADKLIKLYCH 718 >ref|XP_003540150.1| PREDICTED: ribosome biogenesis protein BOP1 homolog [Glycine max] Length = 716 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 ++NGRG++DCKFHPR PWLFTAGAD +IKLY H Sbjct: 684 NSNGRGILDCKFHPRQPWLFTAGADKLIKLYCH 716 >ref|XP_003592946.1| Ribosome biogenesis protein bop1 [Medicago truncatula] gi|355481994|gb|AES63197.1| Ribosome biogenesis protein bop1 [Medicago truncatula] Length = 786 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 2 STNGRGVMDCKFHPRLPWLFTAGADSVIKLYVH 100 ++NGRG++DCKFHPR PWLFTAGAD +IKLY H Sbjct: 753 NSNGRGILDCKFHPRQPWLFTAGADKMIKLYCH 785