BLASTX nr result
ID: Paeonia23_contig00001827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00001827 (2647 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513578.1| heat shock protein binding protein, putative... 64 4e-07 >ref|XP_002513578.1| heat shock protein binding protein, putative [Ricinus communis] gi|223547486|gb|EEF48981.1| heat shock protein binding protein, putative [Ricinus communis] Length = 753 Score = 63.9 bits (154), Expect = 4e-07 Identities = 32/76 (42%), Positives = 46/76 (60%) Frame = -2 Query: 636 VLGCLPWMQNAV*IS*KAQEACSYVHSNKNKGFGANGPFKMV*KAWNLLSDKAKR*TCN* 457 VLG PW + + + ++ +H +KNK GA+G FK+V +AW+LLSDKAKR N Sbjct: 71 VLGVSPWADDET-VKKQYRKLALMLHPDKNKSLGADGAFKLVSEAWSLLSDKAKRLAYNE 129 Query: 456 RFNLHGFQNKVQTHRK 409 + N+ GF + TH K Sbjct: 130 KLNVIGFHQNISTHTK 145