BLASTX nr result
ID: Paeonia23_contig00001314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00001314 (2069 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN66510.1| hypothetical protein VITISV_003620 [Vitis vinifera] 59 9e-06 >emb|CAN66510.1| hypothetical protein VITISV_003620 [Vitis vinifera] Length = 2197 Score = 58.9 bits (141), Expect = 9e-06 Identities = 44/131 (33%), Positives = 66/131 (50%), Gaps = 11/131 (8%) Frame = +3 Query: 123 FHTVAFSEGGVRVPLHPLYCSFLKRVGLLPTQCSPNLHKVINGFVKLESRLPGNVHLVLD 302 F ++ E G+RVP PL FL GL P+Q PN+ +V+ G + + + + L L Sbjct: 40 FLHISHFEAGLRVPFPPLIRRFLNFFGLPPSQIHPNVCRVLMGCLVINQK--AGLDLGLA 97 Query: 303 DLSHYYRLVKKRDK----YVLEIRNEVYPVTHLPDHHRGYGEYVVYLT-----GYFETHD 455 ++ + Y L KK +K Y+ I+ VT LPD +G+ V L+ G +E H Sbjct: 98 EVLYCYSLKKKIEKRETYYLSTIKKPHSFVTDLPDSEKGWNNGYVVLSGRWEFGAWEEHQ 157 Query: 456 --KCPRVAGNP 482 + PRV GNP Sbjct: 158 LWETPRVLGNP 168