BLASTX nr result
ID: Paeonia23_contig00000832
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia23_contig00000832 (258 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285417.2| PREDICTED: proteasome subunit beta type-7-B ... 67 3e-09 ref|XP_002285415.1| PREDICTED: proteasome subunit beta type-7-B ... 67 3e-09 gb|AFK43542.1| unknown [Lotus japonicus] 64 2e-08 ref|XP_006446663.1| hypothetical protein CICLE_v10016241mg [Citr... 63 5e-08 ref|XP_006446662.1| hypothetical protein CICLE_v10016241mg [Citr... 63 5e-08 ref|XP_007160944.1| hypothetical protein PHAVU_001G030300g [Phas... 62 6e-08 ref|XP_007031655.1| N-terminal nucleophile aminohydrolases (Ntn ... 60 2e-07 ref|XP_007142405.1| hypothetical protein PHAVU_008G277700g [Phas... 60 3e-07 ref|XP_007133840.1| hypothetical protein PHAVU_011G213400g [Phas... 60 3e-07 ref|XP_004139648.1| PREDICTED: proteasome subunit beta type-7-B-... 60 4e-07 gb|AEK05509.1| 20S proteasome beta subunit [Dimocarpus longan] 59 7e-07 gb|ACJ85471.1| unknown [Medicago truncatula] 59 7e-07 ref|XP_002323800.1| 20S proteasome beta subunit B family protein... 59 7e-07 ref|XP_003622446.1| Proteasome subunit beta type [Medicago trunc... 59 7e-07 ref|XP_004491746.1| PREDICTED: proteasome subunit beta type-7-B-... 59 9e-07 ref|XP_003622316.1| Proteasome subunit beta type [Medicago trunc... 59 9e-07 gb|EYU30605.1| hypothetical protein MIMGU_mgv1a011710mg [Mimulus... 58 1e-06 ref|XP_003519624.1| PREDICTED: proteasome subunit beta type-7-B-... 58 1e-06 gb|ACJ84568.1| unknown [Medicago truncatula] 58 2e-06 ref|XP_004159076.1| PREDICTED: proteasome subunit beta type-7-A-... 57 3e-06 >ref|XP_002285417.2| PREDICTED: proteasome subunit beta type-7-B isoform 2 [Vitis vinifera] Length = 267 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +V+ KGY+FPKPIEVL TK+TPLK+KVEVIEGG+AMEE Sbjct: 230 YVSAKGYSFPKPIEVLLTKVTPLKEKVEVIEGGDAMEE 267 >ref|XP_002285415.1| PREDICTED: proteasome subunit beta type-7-B isoform 1 [Vitis vinifera] gi|296081387|emb|CBI16820.3| unnamed protein product [Vitis vinifera] Length = 273 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +V+ KGY+FPKPIEVL TK+TPLK+KVEVIEGG+AMEE Sbjct: 236 YVSAKGYSFPKPIEVLLTKVTPLKEKVEVIEGGDAMEE 273 >gb|AFK43542.1| unknown [Lotus japonicus] Length = 272 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +VNPKG+TF K EVL TKITPLK+KVEVIEGG+AMEE Sbjct: 235 YVNPKGFTFSKKTEVLLTKITPLKEKVEVIEGGDAMEE 272 >ref|XP_006446663.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] gi|557549274|gb|ESR59903.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] Length = 250 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FVN KGY+FPK EVL TKITPL+++VEV+EGG+AMEE Sbjct: 213 FVNAKGYSFPKKTEVLLTKITPLRERVEVVEGGDAMEE 250 >ref|XP_006446662.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] gi|568831934|ref|XP_006470201.1| PREDICTED: proteasome subunit beta type-7-B-like [Citrus sinensis] gi|557549273|gb|ESR59902.1| hypothetical protein CICLE_v10016241mg [Citrus clementina] Length = 273 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 34/38 (89%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FVN KGY+FPK EVL TKITPL+++VEV+EGG+AMEE Sbjct: 236 FVNAKGYSFPKKTEVLLTKITPLRERVEVVEGGDAMEE 273 >ref|XP_007160944.1| hypothetical protein PHAVU_001G030300g [Phaseolus vulgaris] gi|561034408|gb|ESW32938.1| hypothetical protein PHAVU_001G030300g [Phaseolus vulgaris] Length = 271 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +VNPKG+ FPK IEVLSTKITPLK+KVEVIE G+AMEE Sbjct: 235 YVNPKGFEFPKKIEVLSTKITPLKEKVEVIE-GDAMEE 271 >ref|XP_007031655.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein [Theobroma cacao] gi|508710684|gb|EOY02581.1| N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein [Theobroma cacao] Length = 273 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 + + KGY+FPK EVL TKITPLK+KVE+IEGG+AMEE Sbjct: 236 YTSSKGYSFPKKTEVLLTKITPLKEKVEIIEGGDAMEE 273 >ref|XP_007142405.1| hypothetical protein PHAVU_008G277700g [Phaseolus vulgaris] gi|561015538|gb|ESW14399.1| hypothetical protein PHAVU_008G277700g [Phaseolus vulgaris] Length = 271 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +VNPKG+ FPK IEVL TKITPLK+KVEVIE G+AMEE Sbjct: 235 YVNPKGFEFPKKIEVLLTKITPLKEKVEVIE-GDAMEE 271 >ref|XP_007133840.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] gi|593263324|ref|XP_007133841.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] gi|561006840|gb|ESW05834.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] gi|561006841|gb|ESW05835.1| hypothetical protein PHAVU_011G213400g [Phaseolus vulgaris] Length = 271 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +VNPKG+ FPK IEVL TKITPLK+KVEVIE G+AMEE Sbjct: 235 YVNPKGFEFPKKIEVLLTKITPLKEKVEVIE-GDAMEE 271 >ref|XP_004139648.1| PREDICTED: proteasome subunit beta type-7-B-like [Cucumis sativus] gi|449475427|ref|XP_004154453.1| PREDICTED: proteasome subunit beta type-7-B-like [Cucumis sativus] Length = 273 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +V+ KGY+FPK EVL TKI PLK+KVE+IEGG+AMEE Sbjct: 236 YVSSKGYSFPKKTEVLLTKIMPLKEKVEIIEGGDAMEE 273 >gb|AEK05509.1| 20S proteasome beta subunit [Dimocarpus longan] Length = 268 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FV+ KGY+F K EVLSTKI PLK++VE+IEGG+AMEE Sbjct: 231 FVSSKGYSFSKKTEVLSTKIIPLKERVEIIEGGDAMEE 268 >gb|ACJ85471.1| unknown [Medicago truncatula] Length = 271 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FVNPKG+TF K EVLSTKITPLK+ VEVIE G+AMEE Sbjct: 235 FVNPKGFTFSKKTEVLSTKITPLKENVEVIE-GDAMEE 271 >ref|XP_002323800.1| 20S proteasome beta subunit B family protein [Populus trichocarpa] gi|118484467|gb|ABK94109.1| unknown [Populus trichocarpa] gi|222866802|gb|EEF03933.1| 20S proteasome beta subunit B family protein [Populus trichocarpa] Length = 274 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/38 (68%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +V +GY+FPK EVL TKITPL+++VEVIEGG+AMEE Sbjct: 236 YVTERGYSFPKKTEVLMTKITPLRERVEVIEGGDAMEE 273 >ref|XP_003622446.1| Proteasome subunit beta type [Medicago truncatula] gi|124359794|gb|ABN06120.1| Peptidase T1A, proteasome beta-subunit [Medicago truncatula] gi|355497461|gb|AES78664.1| Proteasome subunit beta type [Medicago truncatula] Length = 271 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FVNPKG+TF K EVLSTKITPLK+ VEVIE G+AMEE Sbjct: 235 FVNPKGFTFSKKTEVLSTKITPLKENVEVIE-GDAMEE 271 >ref|XP_004491746.1| PREDICTED: proteasome subunit beta type-7-B-like [Cicer arietinum] Length = 271 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FVNPKG+TF K EVL TKITPLK+KVEVIE G+AMEE Sbjct: 235 FVNPKGFTFSKKTEVLLTKITPLKEKVEVIE-GDAMEE 271 >ref|XP_003622316.1| Proteasome subunit beta type [Medicago truncatula] gi|355497331|gb|AES78534.1| Proteasome subunit beta type [Medicago truncatula] Length = 271 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FVNPKG+TF K EVL TKITPLK+KVEVIE G+AMEE Sbjct: 235 FVNPKGFTFSKKTEVLLTKITPLKEKVEVIE-GDAMEE 271 >gb|EYU30605.1| hypothetical protein MIMGU_mgv1a011710mg [Mimulus guttatus] Length = 273 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +V+ KGYTF K EVL TKITPLK+ VEVIEGG+AMEE Sbjct: 236 YVSAKGYTFSKKTEVLLTKITPLKELVEVIEGGDAMEE 273 >ref|XP_003519624.1| PREDICTED: proteasome subunit beta type-7-B-like isoform X1 [Glycine max] gi|356552635|ref|XP_003544669.1| PREDICTED: proteasome subunit beta type-7-B-like isoformX1 [Glycine max] gi|356552637|ref|XP_003544670.1| PREDICTED: proteasome subunit beta type-7-B-like isoformX2 [Glycine max] gi|571442369|ref|XP_006575709.1| PREDICTED: proteasome subunit beta type-7-B-like isoform X2 [Glycine max] gi|571506377|ref|XP_006595695.1| PREDICTED: proteasome subunit beta type-7-B-like isoform X3 [Glycine max] Length = 271 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +VNPKG+ FPK EVL TKITPLK+KVEVIE G+AMEE Sbjct: 235 YVNPKGFDFPKKTEVLLTKITPLKEKVEVIE-GDAMEE 271 >gb|ACJ84568.1| unknown [Medicago truncatula] Length = 271 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 FVNPKG+TF K EVL TKITPLK+KVEVIE G+AMEE Sbjct: 235 FVNPKGFTFSKKNEVLLTKITPLKEKVEVIE-GDAMEE 271 >ref|XP_004159076.1| PREDICTED: proteasome subunit beta type-7-A-like [Cucumis sativus] Length = 273 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 256 FVNPKGYTFPKPIEVLSTKITPLKQKVEVIEGGEAMEE 143 +V+ KGY+FPK EVL TKI PLK+KVEVIE G+AMEE Sbjct: 236 YVSSKGYSFPKKTEVLLTKIMPLKEKVEVIERGDAMEE 273