BLASTX nr result
ID: Paeonia22_contig00047411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00047411 (239 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007293140.1| hypothetical protein MBM_05251 [Marssonina b... 159 5e-37 ref|XP_001594407.1| hypothetical protein SS1G_04214 [Sclerotinia... 152 5e-35 ref|XP_001561199.1| hypothetical protein BC1G_00284 [Botryotinia... 152 5e-35 emb|CCD45711.1| similar to carbamoyl-phosphate synthase arginine... 151 1e-34 gb|ESZ89760.1| putative Carbamoyl-phosphate synthase arginine-sp... 146 3e-33 gb|EHK97409.1| putative Carbamoyl-phosphate synthase arginine-sp... 146 3e-33 gb|EPQ62158.1| Small subunit of carbamoyl phosphate synthetase [... 145 4e-33 emb|CCU81979.1| putative carbamoyl-phosphate synthase arginine-s... 144 1e-32 dbj|GAD91931.1| carbamoyl-phosphate synthase, small subunit [Bys... 132 4e-29 gb|EME45497.1| hypothetical protein DOTSEDRAFT_150573 [Dothistro... 132 4e-29 gb|EON64446.1| carbamoyl-phosphate synthase arginine-specific sm... 131 1e-28 ref|XP_001223728.1| carbamoyl-phosphate synthase, mitochondrial ... 130 2e-28 gb|EZF34604.1| carbamoyl-phosphate synthase arginine-specific sm... 130 2e-28 ref|XP_003660363.1| hypothetical protein MYCTH_2314123 [Myceliop... 130 2e-28 gb|EGE03992.1| carbamoyl-phosphate synthase subunit arginine-spe... 130 2e-28 gb|EGD92547.1| carbamoyl-phosphate synthase subunit arginine-spe... 130 2e-28 ref|XP_003234973.1| carbamoyl-phosphate synthase subunit arginin... 130 2e-28 ref|XP_003020977.1| hypothetical protein TRV_04842 [Trichophyton... 130 2e-28 ref|XP_003046651.1| predicted protein [Nectria haematococca mpVI... 129 6e-28 ref|XP_003017170.1| hypothetical protein ARB_04047 [Arthroderma ... 128 7e-28 >ref|XP_007293140.1| hypothetical protein MBM_05251 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406863735|gb|EKD16782.1| hypothetical protein MBM_05251 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 467 Score = 159 bits (401), Expect = 5e-37 Identities = 78/79 (98%), Positives = 78/79 (98%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPA A Sbjct: 367 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPA-A 425 Query: 57 GKDNRPSPLLVDILAKERV 1 GKDNRPSPLLVDILAKERV Sbjct: 426 GKDNRPSPLLVDILAKERV 444 >ref|XP_001594407.1| hypothetical protein SS1G_04214 [Sclerotinia sclerotiorum 1980] gi|154702000|gb|EDO01739.1| hypothetical protein SS1G_04214 [Sclerotinia sclerotiorum 1980 UF-70] Length = 457 Score = 152 bits (384), Expect = 5e-35 Identities = 74/79 (93%), Positives = 76/79 (96%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYK NQAVYP A Sbjct: 368 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKKNQAVYP--A 425 Query: 57 GKDNRPSPLLVDILAKERV 1 GKDNRP+PLLVDIL+KERV Sbjct: 426 GKDNRPNPLLVDILSKERV 444 >ref|XP_001561199.1| hypothetical protein BC1G_00284 [Botryotinia fuckeliana B05.10] gi|472239578|gb|EMR84384.1| putative carbamoyl-phosphate synthase arginine-specific small chain protein [Botryotinia fuckeliana BcDW1] Length = 455 Score = 152 bits (384), Expect = 5e-35 Identities = 74/79 (93%), Positives = 76/79 (96%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYK NQAVYP A Sbjct: 368 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKKNQAVYP--A 425 Query: 57 GKDNRPSPLLVDILAKERV 1 GKDNRP+PLLVDIL+KERV Sbjct: 426 GKDNRPNPLLVDILSKERV 444 >emb|CCD45711.1| similar to carbamoyl-phosphate synthase arginine-specific small chain [Botryotinia fuckeliana T4] Length = 455 Score = 151 bits (381), Expect = 1e-34 Identities = 73/79 (92%), Positives = 76/79 (96%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYK NQAVYP A Sbjct: 368 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKKNQAVYP--A 425 Query: 57 GKDNRPSPLLVDILAKERV 1 GKDN+P+PLLVDIL+KERV Sbjct: 426 GKDNKPNPLLVDILSKERV 444 >gb|ESZ89760.1| putative Carbamoyl-phosphate synthase arginine-specific small chain [Sclerotinia borealis F-4157] Length = 457 Score = 146 bits (369), Expect = 3e-33 Identities = 71/79 (89%), Positives = 74/79 (93%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQ YK NQAVYP A Sbjct: 368 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQSYKKNQAVYP--A 425 Query: 57 GKDNRPSPLLVDILAKERV 1 GK N+P+PLLVDIL+KERV Sbjct: 426 GKSNKPNPLLVDILSKERV 444 >gb|EHK97409.1| putative Carbamoyl-phosphate synthase arginine-specific small chain [Glarea lozoyensis 74030] gi|512195399|gb|EPE24237.1| Class I glutamine amidotransferase-like protein [Glarea lozoyensis ATCC 20868] Length = 460 Score = 146 bits (369), Expect = 3e-33 Identities = 70/79 (88%), Positives = 75/79 (94%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSS+LFDMYIENV+RYK NQA++P Sbjct: 366 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSFLFDMYIENVKRYKENQAIHP--T 423 Query: 57 GKDNRPSPLLVDILAKERV 1 GKDNRPSPLLVDIL+KERV Sbjct: 424 GKDNRPSPLLVDILSKERV 442 >gb|EPQ62158.1| Small subunit of carbamoyl phosphate synthetase [Blumeria graminis f. sp. tritici 96224] Length = 451 Score = 145 bits (367), Expect = 4e-33 Identities = 68/79 (86%), Positives = 75/79 (94%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 F+NLNDGSNEGM+H+TRPIFSTQFHPEAKGGPMDSSYLFD YIE+V RYKNNQA+YPA Sbjct: 359 FINLNDGSNEGMMHRTRPIFSTQFHPEAKGGPMDSSYLFDQYIESVIRYKNNQAIYPA-I 417 Query: 57 GKDNRPSPLLVDILAKERV 1 GKDNRPSP+L+DILAKERV Sbjct: 418 GKDNRPSPMLIDILAKERV 436 >emb|CCU81979.1| putative carbamoyl-phosphate synthase arginine-specific small chain [Blumeria graminis f. sp. hordei DH14] Length = 451 Score = 144 bits (364), Expect = 1e-32 Identities = 67/79 (84%), Positives = 75/79 (94%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 F+NLNDGSNEGM+H+TRPIFSTQFHPEAKGGPMDSSYLFD YI++V RYKNNQA+YPA Sbjct: 359 FINLNDGSNEGMMHRTRPIFSTQFHPEAKGGPMDSSYLFDQYIDSVIRYKNNQAIYPA-I 417 Query: 57 GKDNRPSPLLVDILAKERV 1 GKDNRPSP+L+DILAKERV Sbjct: 418 GKDNRPSPMLIDILAKERV 436 >dbj|GAD91931.1| carbamoyl-phosphate synthase, small subunit [Byssochlamys spectabilis No. 5] Length = 466 Score = 132 bits (333), Expect = 4e-29 Identities = 62/79 (78%), Positives = 74/79 (93%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGMIHK+RPIFSTQFHPEAKGGP+DSSYLFD+Y+E+VQ+Y+N+QAV+ Sbjct: 365 FVNLNDGSNEGMIHKSRPIFSTQFHPEAKGGPLDSSYLFDIYLESVQKYRNSQAVFQPM- 423 Query: 57 GKDNRPSPLLVDILAKERV 1 +D+RPSPLLVD+LAKERV Sbjct: 424 -RDSRPSPLLVDLLAKERV 441 >gb|EME45497.1| hypothetical protein DOTSEDRAFT_150573 [Dothistroma septosporum NZE10] Length = 456 Score = 132 bits (333), Expect = 4e-29 Identities = 63/79 (79%), Positives = 70/79 (88%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 F NLNDGSNEGMIHKTRPIFSTQFHPEAKGGP+DSSYLFD Y+++VQ+YK NQ V Sbjct: 367 FTNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDAYLQSVQQYKQNQDV--LKG 424 Query: 57 GKDNRPSPLLVDILAKERV 1 G+DNRPSPLLVD+LAKERV Sbjct: 425 GRDNRPSPLLVDLLAKERV 443 >gb|EON64446.1| carbamoyl-phosphate synthase arginine-specific small chain [Coniosporium apollinis CBS 100218] Length = 477 Score = 131 bits (329), Expect = 1e-28 Identities = 62/79 (78%), Positives = 72/79 (91%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLND SNEGMIHK+RPIFS QFHPEAKGGP+DS+YLFD YIENV++YKN+QAV+ S Sbjct: 370 FVNLNDSSNEGMIHKSRPIFSAQFHPEAKGGPLDSAYLFDAYIENVKKYKNSQAVF--SP 427 Query: 57 GKDNRPSPLLVDILAKERV 1 KDN+PSPLLVD+L+KERV Sbjct: 428 QKDNKPSPLLVDLLSKERV 446 >ref|XP_001223728.1| carbamoyl-phosphate synthase, mitochondrial precursor [Chaetomium globosum CBS 148.51] gi|121783423|sp|Q2H132.1|CARA_CHAGB RecName: Full=Carbamoyl-phosphate synthase arginine-specific small chain; Short=CPS-A; AltName: Full=Arginine-specific carbamoyl-phosphate synthetase, glutamine chain gi|88180427|gb|EAQ87895.1| carbamoyl-phosphate synthase, mitochondrial precursor [Chaetomium globosum CBS 148.51] Length = 461 Score = 130 bits (327), Expect = 2e-28 Identities = 62/79 (78%), Positives = 69/79 (87%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGM+HKTRPIFSTQFHPEAKGGPMDSSYLFD Y+ENVQ YK+N VY Sbjct: 376 FVNLNDGSNEGMMHKTRPIFSTQFHPEAKGGPMDSSYLFDKYLENVQMYKDNSKVY---- 431 Query: 57 GKDNRPSPLLVDILAKERV 1 +DNRPS L++DIL+KERV Sbjct: 432 -RDNRPSQLMIDILSKERV 449 >gb|EZF34604.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton interdigitale H6] Length = 474 Score = 130 bits (326), Expect = 2e-28 Identities = 60/79 (75%), Positives = 70/79 (88%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLND SNEGMIHKTRPIFSTQFHPEAKGGP+DSSYLFD+Y+++VQ+YK NQA++ Sbjct: 372 FVNLNDNSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDIYLDSVQKYKANQAIH--QP 429 Query: 57 GKDNRPSPLLVDILAKERV 1 G+DNRPSPLL D+L ERV Sbjct: 430 GRDNRPSPLLADLLGNERV 448 >ref|XP_003660363.1| hypothetical protein MYCTH_2314123 [Myceliophthora thermophila ATCC 42464] gi|347007630|gb|AEO55118.1| hypothetical protein MYCTH_2314123 [Myceliophthora thermophila ATCC 42464] Length = 441 Score = 130 bits (326), Expect = 2e-28 Identities = 62/79 (78%), Positives = 69/79 (87%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGM+HKTRPIFSTQFHPEAKGGPMDSSYLFD Y+ENVQ YK+N VY Sbjct: 356 FVNLNDGSNEGMMHKTRPIFSTQFHPEAKGGPMDSSYLFDKYLENVQMYKDNAKVY---- 411 Query: 57 GKDNRPSPLLVDILAKERV 1 +DNRPS L++DIL+KERV Sbjct: 412 -RDNRPSQLMIDILSKERV 429 >gb|EGE03992.1| carbamoyl-phosphate synthase subunit arginine-specific small [Trichophyton equinum CBS 127.97] Length = 542 Score = 130 bits (326), Expect = 2e-28 Identities = 60/79 (75%), Positives = 70/79 (88%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLND SNEGMIHKTRPIFSTQFHPEAKGGP+DSSYLFD+Y+++VQ+YK NQA++ Sbjct: 440 FVNLNDNSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDIYLDSVQKYKANQAIH--QP 497 Query: 57 GKDNRPSPLLVDILAKERV 1 G+DNRPSPLL D+L ERV Sbjct: 498 GRDNRPSPLLADLLGNERV 516 >gb|EGD92547.1| carbamoyl-phosphate synthase subunit arginine-specific small [Trichophyton tonsurans CBS 112818] Length = 534 Score = 130 bits (326), Expect = 2e-28 Identities = 60/79 (75%), Positives = 70/79 (88%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLND SNEGMIHKTRPIFSTQFHPEAKGGP+DSSYLFD+Y+++VQ+YK NQA++ Sbjct: 432 FVNLNDNSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDIYLDSVQKYKANQAIH--QP 489 Query: 57 GKDNRPSPLLVDILAKERV 1 G+DNRPSPLL D+L ERV Sbjct: 490 GRDNRPSPLLADLLGNERV 508 >ref|XP_003234973.1| carbamoyl-phosphate synthase subunit arginine-specific small [Trichophyton rubrum CBS 118892] gi|326462325|gb|EGD87778.1| carbamoyl-phosphate synthase subunit arginine-specific small [Trichophyton rubrum CBS 118892] gi|607877619|gb|EZF22732.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum MR850] gi|607904586|gb|EZF41986.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum CBS 100081] gi|607916740|gb|EZF52691.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum CBS 288.86] gi|607928680|gb|EZF63191.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum CBS 289.86] gi|607940709|gb|EZF73925.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton soudanense CBS 452.61] gi|607952804|gb|EZF84621.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum MR1448] gi|607964836|gb|EZF95207.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum MR1459] gi|607977116|gb|EZG06280.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum CBS 735.88] gi|607988810|gb|EZG16760.1| carbamoyl-phosphate synthase arginine-specific small chain [Trichophyton rubrum CBS 202.88] Length = 474 Score = 130 bits (326), Expect = 2e-28 Identities = 60/79 (75%), Positives = 70/79 (88%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLND SNEGMIHKTRPIFSTQFHPEAKGGP+DSSYLFD+Y+++VQ+YK NQA++ Sbjct: 372 FVNLNDNSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDIYLDSVQKYKANQAIH--QP 429 Query: 57 GKDNRPSPLLVDILAKERV 1 G+DNRPSPLL D+L ERV Sbjct: 430 GRDNRPSPLLADLLGNERV 448 >ref|XP_003020977.1| hypothetical protein TRV_04842 [Trichophyton verrucosum HKI 0517] gi|291184852|gb|EFE40359.1| hypothetical protein TRV_04842 [Trichophyton verrucosum HKI 0517] Length = 440 Score = 130 bits (326), Expect = 2e-28 Identities = 60/79 (75%), Positives = 70/79 (88%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLND SNEGMIHKTRPIFSTQFHPEAKGGP+DSSYLFD+Y+++VQ+YK NQA++ Sbjct: 338 FVNLNDNSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDIYLDSVQKYKANQAIH--QP 395 Query: 57 GKDNRPSPLLVDILAKERV 1 G+DNRPSPLL D+L ERV Sbjct: 396 GRDNRPSPLLADLLGNERV 414 >ref|XP_003046651.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256727578|gb|EEU40938.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 456 Score = 129 bits (323), Expect = 6e-28 Identities = 61/79 (77%), Positives = 70/79 (88%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLNDGSNEGM+HKTRPIFSTQFHPEAKGGPMDSSYLFD Y++NVQ K+NQ VY Sbjct: 372 FVNLNDGSNEGMMHKTRPIFSTQFHPEAKGGPMDSSYLFDKYLQNVQLAKSNQTVY---- 427 Query: 57 GKDNRPSPLLVDILAKERV 1 KDNRPSPL++DIL+++RV Sbjct: 428 -KDNRPSPLMLDILSRQRV 445 >ref|XP_003017170.1| hypothetical protein ARB_04047 [Arthroderma benhamiae CBS 112371] gi|291180741|gb|EFE36525.1| hypothetical protein ARB_04047 [Arthroderma benhamiae CBS 112371] Length = 431 Score = 128 bits (322), Expect = 7e-28 Identities = 60/79 (75%), Positives = 69/79 (87%) Frame = -3 Query: 237 FVNLNDGSNEGMIHKTRPIFSTQFHPEAKGGPMDSSYLFDMYIENVQRYKNNQAVYPASA 58 FVNLND SNEGMIHKTRPIFSTQFHPEAKGGP+DSSYLFD+Y+++VQ+YK NQA+ Sbjct: 329 FVNLNDNSNEGMIHKTRPIFSTQFHPEAKGGPLDSSYLFDIYLDSVQKYKANQAI--NQP 386 Query: 57 GKDNRPSPLLVDILAKERV 1 G+DNRPSPLL D+L ERV Sbjct: 387 GRDNRPSPLLADLLGNERV 405