BLASTX nr result
ID: Paeonia22_contig00044178
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00044178 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159272.1| PREDICTED: uncharacterized mitochondrial pro... 44 1e-08 gb|ABR16288.1| unknown [Picea sitchensis] 40 6e-07 gb|ABR67407.1| integrase [Cucumis melo subsp. melo] 44 3e-06 >ref|XP_004159272.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like [Cucumis sativus] Length = 170 Score = 43.5 bits (101), Expect(2) = 1e-08 Identities = 22/45 (48%), Positives = 28/45 (62%) Frame = -1 Query: 446 NGVFILQK*HANDLLIKFRMNGASPWNTPMHAGLKISSDNA*DDF 312 N + I QK +A DLL KF+M A P NTPM GLK+S + + F Sbjct: 35 NEIAIFQKKYAKDLLKKFKMENAYPANTPMELGLKLSKHDVSEAF 79 Score = 41.6 bits (96), Expect(2) = 1e-08 Identities = 21/40 (52%), Positives = 29/40 (72%), Gaps = 8/40 (20%) Frame = -2 Query: 313 FDATLYTRLVGNLM*LTTTRPNLM--------FLSTPKRT 218 FDAT+Y LVG+LM LTTTRP++M F+++PKR+ Sbjct: 79 FDATIYRSLVGSLMYLTTTRPDIMFFVSLLSRFMTSPKRS 118 >gb|ABR16288.1| unknown [Picea sitchensis] Length = 363 Score = 40.4 bits (93), Expect(2) = 6e-07 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 8/44 (18%) Frame = -2 Query: 325 HEMIFDATLYTRLVGNLM*LTTTRPNLM--------FLSTPKRT 218 +EM FD+T++ +LVG+LM LT TRP++M F+ TPK + Sbjct: 263 NEMDFDSTIFRKLVGSLMYLTATRPDIMYGVSLISRFMDTPKNS 306 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = -1 Query: 443 GVFILQK*HANDLLIKFRMNGASPWNTPMHAGLKISSDNA*DDF 312 G+FI Q +A D+L +FRM SP +TP+ G K+S + DF Sbjct: 224 GIFICQSKYARDVLKRFRMINCSPVSTPVGVGTKLSREQNEMDF 267 >gb|ABR67407.1| integrase [Cucumis melo subsp. melo] Length = 1281 Score = 43.5 bits (101), Expect(2) = 3e-06 Identities = 21/38 (55%), Positives = 27/38 (71%) Frame = -1 Query: 440 VFILQK*HANDLLIKFRMNGASPWNTPMHAGLKISSDN 327 + I Q+ +A+DLL KFRM ASP NTPM A LK+ D+ Sbjct: 1016 IVISQQKYAHDLLKKFRMENASPCNTPMDANLKLCKDD 1053 Score = 33.1 bits (74), Expect(2) = 3e-06 Identities = 17/39 (43%), Positives = 25/39 (64%), Gaps = 8/39 (20%) Frame = -2 Query: 310 DATLYTRLVGNLM*LTTTRPNLM--------FLSTPKRT 218 D +LY LVG+LM LT TRP+++ F++ PKR+ Sbjct: 1059 DPSLYRSLVGSLMYLTATRPDILFVVSMLSRFMTNPKRS 1097