BLASTX nr result
ID: Paeonia22_contig00036415
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00036415 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280513.1| PREDICTED: pentatricopeptide repeat-containi... 79 7e-13 ref|XP_006494311.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 >ref|XP_002280513.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170 [Vitis vinifera] gi|297738768|emb|CBI28013.3| unnamed protein product [Vitis vinifera] Length = 479 Score = 79.0 bits (193), Expect = 7e-13 Identities = 46/91 (50%), Positives = 58/91 (63%) Frame = -3 Query: 274 PLLLRLSRVQNPEYLFISHNLNQKLITSSIHFNAQPNLQSPTRSPSFSNPYEDQAKLIAN 95 P LLRLS VQ P+ IS +L L T++ +AQ N Q PT P +P +D A+ IA+ Sbjct: 6 PPLLRLSIVQIPKPQTISRHLCNYLATTTHSVDAQFNFQ-PTAHPPSPDPIQDTAQTIAS 64 Query: 94 HLSNCSDLHRLNQIYAHIIRTRLLELYPCAF 2 HLS C++L LNQ+ AHIIRT LELYP F Sbjct: 65 HLSKCANLIELNQLLAHIIRTHFLELYPAPF 95 >ref|XP_006494311.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Citrus sinensis] Length = 471 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -3 Query: 139 SFSNPYEDQAKLIANHLSNCSDLHRLNQIYAHIIRTRLLELYPCAF 2 SF + +ED AK++A LS C++L +LNQIYAHIIRT +L Y AF Sbjct: 42 SFLDTHEDPAKIVATQLSKCTNLLQLNQIYAHIIRTHMLHSYSAAF 87