BLASTX nr result
ID: Paeonia22_contig00027753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00027753 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006470591.1| PREDICTED: ADP,ATP carrier protein, mitochon... 71 1e-10 ref|XP_006446100.1| hypothetical protein CICLE_v10017600mg [Citr... 71 1e-10 ref|XP_007211408.1| hypothetical protein PRUPE_ppa006913mg [Prun... 71 1e-10 ref|XP_002285503.1| PREDICTED: ADP,ATP carrier protein, mitochon... 71 1e-10 emb|CBI16399.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_006439128.1| hypothetical protein CICLE_v10033595mg [Citr... 71 2e-10 dbj|BAD91181.1| putative mitochondrial adenylate transporter [Me... 70 2e-10 ref|XP_004513729.1| PREDICTED: ADP,ATP carrier protein 1, mitoch... 70 3e-10 ref|XP_002299232.1| hypothetical protein POPTR_0001s05690g [Popu... 70 3e-10 ref|XP_004291800.1| PREDICTED: ADP,ATP carrier protein, mitochon... 70 4e-10 gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo sub... 70 4e-10 gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo sub... 70 4e-10 ref|XP_002513475.1| ADP,ATP carrier protein, putative [Ricinus c... 70 4e-10 sp|P27081.1|ADT2_SOLTU RecName: Full=ADP,ATP carrier protein, mi... 69 5e-10 ref|XP_004142870.1| PREDICTED: ADP,ATP carrier protein 1, mitoch... 69 5e-10 ref|XP_004142869.1| PREDICTED: ADP,ATP carrier protein 1, mitoch... 69 5e-10 ref|NP_001275490.1| ADP,ATP carrier protein, mitochondrial [Sola... 69 5e-10 gb|EPS71896.1| hypothetical protein M569_02862, partial [Genlise... 69 7e-10 ref|XP_007014994.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao... 69 7e-10 ref|XP_007052542.1| ADP/ATP carrier 2 [Theobroma cacao] gi|50870... 69 7e-10 >ref|XP_006470591.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Citrus sinensis] Length = 394 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK VILTGKL S++ Sbjct: 256 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVILTGKLQDSFF 300 >ref|XP_006446100.1| hypothetical protein CICLE_v10017600mg [Citrus clementina] gi|557548711|gb|ESR59340.1| hypothetical protein CICLE_v10017600mg [Citrus clementina] Length = 394 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK VILTGKL S++ Sbjct: 256 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVILTGKLQDSFF 300 >ref|XP_007211408.1| hypothetical protein PRUPE_ppa006913mg [Prunus persica] gi|462407273|gb|EMJ12607.1| hypothetical protein PRUPE_ppa006913mg [Prunus persica] Length = 390 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK VILTGKL S++ Sbjct: 252 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVILTGKLQDSFF 296 >ref|XP_002285503.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Vitis vinifera] Length = 393 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK VILTGKL S++ Sbjct: 255 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVILTGKLQDSFF 299 >emb|CBI16399.3| unnamed protein product [Vitis vinifera] Length = 296 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK VILTGKL S++ Sbjct: 158 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVILTGKLQDSFF 202 >ref|XP_006439128.1| hypothetical protein CICLE_v10033595mg [Citrus clementina] gi|568858709|ref|XP_006482889.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Citrus sinensis] gi|557541324|gb|ESR52368.1| hypothetical protein CICLE_v10033595mg [Citrus clementina] Length = 385 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGKL S++ Sbjct: 247 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGKLQDSFF 291 >dbj|BAD91181.1| putative mitochondrial adenylate transporter [Mesembryanthemum crystallinum] Length = 388 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGKL S++ Sbjct: 250 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKLQDSFF 294 >ref|XP_004513729.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cicer arietinum] Length = 389 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DG+ GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGKL S++ Sbjct: 251 DGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKLQDSFF 295 >ref|XP_002299232.1| hypothetical protein POPTR_0001s05690g [Populus trichocarpa] gi|222846490|gb|EEE84037.1| hypothetical protein POPTR_0001s05690g [Populus trichocarpa] Length = 385 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 247 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGKMQDSFF 291 >ref|XP_004291800.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 394 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 256 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKMQDSFF 300 >gb|ADN33720.1| adenine nucleotide translocator [Cucumis melo subsp. melo] Length = 390 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 252 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKMQDSFF 296 >gb|ADN33719.1| adenine nucleotide translocator [Cucumis melo subsp. melo] Length = 390 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 252 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKMQDSFF 296 >ref|XP_002513475.1| ADP,ATP carrier protein, putative [Ricinus communis] gi|223547383|gb|EEF48878.1| ADP,ATP carrier protein, putative [Ricinus communis] Length = 363 Score = 69.7 bits (169), Expect = 4e-10 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL 101 DG+ GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGKL Sbjct: 225 DGVAGLYRGFNISCVGIIIYRGLYFGMYDSLKPVVLTGKL 264 >sp|P27081.1|ADT2_SOLTU RecName: Full=ADP,ATP carrier protein, mitochondrial; AltName: Full=ADP/ATP translocase; AltName: Full=Adenine nucleotide translocator; Short=ANT; Flags: Precursor gi|21405|emb|CAA40782.1| adenine nucleotide translocator [Solanum tuberosum] Length = 386 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DG+ GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 248 DGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKMEDSFF 292 >ref|XP_004142870.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cucumis sativus] Length = 390 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DG+ GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 252 DGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKMQDSFF 296 >ref|XP_004142869.1| PREDICTED: ADP,ATP carrier protein 1, mitochondrial-like [Cucumis sativus] Length = 390 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DG+ GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 252 DGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKMQDSFF 296 >ref|NP_001275490.1| ADP,ATP carrier protein, mitochondrial [Solanum tuberosum] gi|565391002|ref|XP_006361217.1| PREDICTED: ADP,ATP carrier protein, mitochondrial-like [Solanum tuberosum] gi|418731470|gb|AFX67036.1| ADP, ATP carrier protein [Solanum tuberosum] Length = 387 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DG+ GLY GFNISCVG+I+Y GLYFGM++SLK V+LTGK+ S++ Sbjct: 249 DGVAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVLLTGKMEDSFF 293 >gb|EPS71896.1| hypothetical protein M569_02862, partial [Genlisea aurea] Length = 316 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTG L S++ Sbjct: 178 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGSLQDSFF 222 >ref|XP_007014994.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] gi|590583787|ref|XP_007014995.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] gi|508785357|gb|EOY32613.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] gi|508785358|gb|EOY32614.1| ADP/ATP carrier 2 isoform 1 [Theobroma cacao] Length = 391 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+L GKL S++ Sbjct: 253 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLVGKLQDSFF 297 >ref|XP_007052542.1| ADP/ATP carrier 2 [Theobroma cacao] gi|508704803|gb|EOX96699.1| ADP/ATP carrier 2 [Theobroma cacao] Length = 507 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = -3 Query: 220 DGIVGLYYGFNISCVGVILYLGLYFGMHESLKHVILTGKL*VSYY 86 DGI GLY GFNISCVG+I+Y GLYFGM++SLK V+LTG L S++ Sbjct: 369 DGIAGLYRGFNISCVGIIVYRGLYFGMYDSLKPVVLTGSLQDSFF 413