BLASTX nr result
ID: Paeonia22_contig00026875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00026875 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72017.1| hypothetical protein VITISV_030157 [Vitis vinifera] 70 4e-10 ref|XP_007045113.1| Uncharacterized protein TCM_010848 [Theobrom... 66 4e-09 ref|XP_002526011.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >emb|CAN72017.1| hypothetical protein VITISV_030157 [Vitis vinifera] Length = 135 Score = 69.7 bits (169), Expect = 4e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = +2 Query: 89 MASMGQCTRPIKGSDFKNQVKNKLPRGPVPPSGPSKCHNKLSPNHQSLFSY 241 MA MG C+RP++G D + ++N+LPRGPVPPSGPS CH+K SP QS SY Sbjct: 1 MAWMGWCSRPMRGEDHQYLLQNRLPRGPVPPSGPSPCHHKFSPVSQSGASY 51 >ref|XP_007045113.1| Uncharacterized protein TCM_010848 [Theobroma cacao] gi|508709048|gb|EOY00945.1| Uncharacterized protein TCM_010848 [Theobroma cacao] Length = 84 Score = 66.2 bits (160), Expect = 4e-09 Identities = 35/60 (58%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +2 Query: 92 ASMGQCTRPI-KGS-DFKNQVKNKLPRGPVPPSGPSKCHNKLSPNHQSLFSYPNGDPICP 265 ASMG C RPI KG+ F + +LPRGPVPPSGPS CHNKL P SY +G ICP Sbjct: 25 ASMGGCIRPINKGTKSFGHLFDTQLPRGPVPPSGPSPCHNKLDPYDYRKVSYSDGYIICP 84 >ref|XP_002526011.1| conserved hypothetical protein [Ricinus communis] gi|223534658|gb|EEF36351.1| conserved hypothetical protein [Ricinus communis] Length = 58 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/47 (59%), Positives = 34/47 (72%), Gaps = 2/47 (4%) Frame = +2 Query: 89 MASMGQCTRPIKG--SDFKNQVKNKLPRGPVPPSGPSKCHNKLSPNH 223 MA+ G C RPIK +++ +N+LPRGPVPPSGPSKCHNK S H Sbjct: 1 MAAPGGCARPIKSVAAEYAYLFENQLPRGPVPPSGPSKCHNKYSQIH 47