BLASTX nr result
ID: Paeonia22_contig00026172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00026172 (570 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007045674.1| F-box/RNI-like superfamily protein [Theobrom... 61 2e-07 ref|XP_004490301.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 60 4e-07 ref|XP_006473429.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 58 2e-06 ref|XP_006434918.1| hypothetical protein CICLE_v10001223mg [Citr... 58 2e-06 ref|XP_002514537.1| ubiquitin-protein ligase, putative [Ricinus ... 58 2e-06 ref|XP_002315980.1| F-box family protein [Populus trichocarpa] g... 57 3e-06 ref|XP_004237207.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 57 3e-06 ref|XP_006375047.1| hypothetical protein POPTR_0014s03910g [Popu... 57 3e-06 ref|XP_003589011.1| F-box/FBD/LRR-repeat protein [Medicago trunc... 57 3e-06 emb|CAN82914.1| hypothetical protein VITISV_031085 [Vitis vinifera] 57 3e-06 ref|XP_007017443.1| F-box/RNI-like superfamily protein isoform 2... 56 6e-06 ref|XP_007017442.1| F-box/RNI-like superfamily protein isoform 1... 56 6e-06 ref|XP_004297176.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 56 6e-06 ref|XP_003588364.1| F-box/FBD/LRR-repeat protein, partial [Medic... 56 6e-06 ref|XP_007222555.1| hypothetical protein PRUPE_ppa006232mg [Prun... 56 8e-06 emb|CBI27434.3| unnamed protein product [Vitis vinifera] 55 1e-05 ref|XP_002459678.1| hypothetical protein SORBIDRAFT_02g008675 [S... 55 1e-05 >ref|XP_007045674.1| F-box/RNI-like superfamily protein [Theobroma cacao] gi|508709609|gb|EOY01506.1| F-box/RNI-like superfamily protein [Theobroma cacao] Length = 499 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/52 (61%), Positives = 38/52 (73%) Frame = -2 Query: 164 KMNRTVGHESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNL 9 K+ R GH SD+I ++P NVIE IL LPIRDAVRTSILSR+WR +W L Sbjct: 60 KVLRRRGH---SDIISNLPDNVIESILGRLPIRDAVRTSILSRSWRYKWTAL 108 >ref|XP_004490301.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Cicer arietinum] Length = 422 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 149 VGHESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLS 6 +G SDLI +P N+IE IL LPIRDAVRTSILSR WR +W +++ Sbjct: 1 MGDVMGSDLISDLPQNIIESILIQLPIRDAVRTSILSRKWRYKWSSIT 48 >ref|XP_006473429.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Citrus sinensis] gi|568838888|ref|XP_006473430.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Citrus sinensis] gi|568838890|ref|XP_006473431.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X3 [Citrus sinensis] gi|568838892|ref|XP_006473432.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X4 [Citrus sinensis] gi|568838894|ref|XP_006473433.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X5 [Citrus sinensis] gi|568838896|ref|XP_006473434.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X6 [Citrus sinensis] gi|568838898|ref|XP_006473435.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X7 [Citrus sinensis] gi|568838900|ref|XP_006473436.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like isoform X8 [Citrus sinensis] Length = 430 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -2 Query: 140 ESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 E+ D + S+P++VI++ILS LPIRDAVRTS+LS+ WR +W + H Sbjct: 14 ETELDRLSSLPAHVIDQILSQLPIRDAVRTSVLSKKWRYKWATVPH 59 >ref|XP_006434918.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] gi|567884721|ref|XP_006434919.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] gi|557537040|gb|ESR48158.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] gi|557537041|gb|ESR48159.1| hypothetical protein CICLE_v10001223mg [Citrus clementina] Length = 430 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/46 (54%), Positives = 36/46 (78%) Frame = -2 Query: 140 ESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 E+ D + S+P++VI++ILS LPIRDAVRTS+LS+ WR +W + H Sbjct: 14 ETELDRLSSLPAHVIDQILSQLPIRDAVRTSVLSKKWRYKWATVPH 59 >ref|XP_002514537.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223546141|gb|EEF47643.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 421 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -2 Query: 149 VGHESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 +G D I +PS++IE IL+ LPIRDAV+TSILS WR +W L+H Sbjct: 1 MGDYEVPDFITDLPSSIIESILTRLPIRDAVKTSILSTKWRYRWATLTH 49 >ref|XP_002315980.1| F-box family protein [Populus trichocarpa] gi|222865020|gb|EEF02151.1| F-box family protein [Populus trichocarpa] Length = 420 Score = 57.4 bits (137), Expect = 3e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = -2 Query: 149 VGHESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 +G DLI +P +++E IL+ LPIRDAVRTSILS WR +W L+H Sbjct: 1 MGDVEDPDLISDLPQSILESILTRLPIRDAVRTSILSSKWRYRWTTLTH 49 >ref|XP_004237207.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Solanum lycopersicum] Length = 477 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 161 MNRTVGHESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLS 6 M V +SD I S+P N I+ IL+ LP+RDAVRTSILSR WR W+ ++ Sbjct: 1 MAEEVASRRSSDRISSLPINAIDDILTRLPLRDAVRTSILSRKWRYDWVKIT 52 >ref|XP_006375047.1| hypothetical protein POPTR_0014s03910g [Populus trichocarpa] gi|550323361|gb|ERP52844.1| hypothetical protein POPTR_0014s03910g [Populus trichocarpa] Length = 416 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -2 Query: 128 DLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 D I S+P +V+++ILS LPIRDAVRTS LSR WR QW + H Sbjct: 6 DRISSLPGHVLDQILSVLPIRDAVRTSALSRKWRYQWSQIPH 47 >ref|XP_003589011.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] gi|355478059|gb|AES59262.1| F-box/FBD/LRR-repeat protein [Medicago truncatula] Length = 528 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/44 (56%), Positives = 35/44 (79%) Frame = -2 Query: 140 ESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNL 9 ++ D I +P +VI++I+S LPIRDAVRTS+LSRNWR++W L Sbjct: 11 DAEPDRISWLPGHVIDQIMSYLPIRDAVRTSVLSRNWRKKWYTL 54 >emb|CAN82914.1| hypothetical protein VITISV_031085 [Vitis vinifera] Length = 341 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = -2 Query: 134 ASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNL 9 A+D I +PSN+I+ IL LPI DAVRTSILSR WR +WL L Sbjct: 7 AADRISXLPSNIIDBILVRLPIHDAVRTSILSRKWRYKWLTL 48 >ref|XP_007017443.1| F-box/RNI-like superfamily protein isoform 2 [Theobroma cacao] gi|508722771|gb|EOY14668.1| F-box/RNI-like superfamily protein isoform 2 [Theobroma cacao] Length = 347 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -2 Query: 140 ESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 E+ D I ++P +VI++ILS LPIRDAVRTS+LSR WR +W + + Sbjct: 18 EAELDKISNLPGHVIDQILSHLPIRDAVRTSVLSRKWRYKWATIPY 63 >ref|XP_007017442.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] gi|508722770|gb|EOY14667.1| F-box/RNI-like superfamily protein isoform 1 [Theobroma cacao] Length = 432 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -2 Query: 140 ESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 E+ D I ++P +VI++ILS LPIRDAVRTS+LSR WR +W + + Sbjct: 18 EAELDKISNLPGHVIDQILSHLPIRDAVRTSVLSRKWRYKWATIPY 63 >ref|XP_004297176.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Fragaria vesca subsp. vesca] Length = 421 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = -2 Query: 149 VGHESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 +G + DLI ++P ++IE IL+ LPI DAVRTS LSR WR +W L+H Sbjct: 1 MGDKPDLDLISNLPQSIIESILTYLPIGDAVRTSCLSRKWRYKWTTLTH 49 >ref|XP_003588364.1| F-box/FBD/LRR-repeat protein, partial [Medicago truncatula] gi|355477412|gb|AES58615.1| F-box/FBD/LRR-repeat protein, partial [Medicago truncatula] Length = 100 Score = 56.2 bits (134), Expect = 6e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -2 Query: 137 SASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLS 6 S DLI +P ++IE IL LPIRDAVRTSILSR WR +W ++ Sbjct: 12 SGPDLISDLPQSIIETILIQLPIRDAVRTSILSRKWRYKWSTIT 55 >ref|XP_007222555.1| hypothetical protein PRUPE_ppa006232mg [Prunus persica] gi|462419491|gb|EMJ23754.1| hypothetical protein PRUPE_ppa006232mg [Prunus persica] Length = 421 Score = 55.8 bits (133), Expect = 8e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -2 Query: 128 DLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 DLI ++P ++IE IL+ LPIRDA+RTS LS WR +W L+H Sbjct: 8 DLISNLPQSIIESILTRLPIRDAIRTSCLSTKWRYKWTTLTH 49 >emb|CBI27434.3| unnamed protein product [Vitis vinifera] Length = 452 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -2 Query: 128 DLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQWLNLSH 3 D+I +P+N+IE IL LPI DAV TSILS+ WR +WL L H Sbjct: 43 DIISDLPNNIIENILMRLPICDAVGTSILSKKWRYKWLTLPH 84 >ref|XP_002459678.1| hypothetical protein SORBIDRAFT_02g008675 [Sorghum bicolor] gi|241923055|gb|EER96199.1| hypothetical protein SORBIDRAFT_02g008675 [Sorghum bicolor] Length = 304 Score = 55.5 bits (132), Expect = 1e-05 Identities = 23/41 (56%), Positives = 33/41 (80%) Frame = -2 Query: 140 ESASDLILSMPSNVIERILSSLPIRDAVRTSILSRNWRRQW 18 E A DL+ +P+++++RIL+ LP RD VRTS+LSR WRR+W Sbjct: 14 ERAVDLLRDLPTHLLDRILAGLPARDVVRTSVLSRPWRRRW 54