BLASTX nr result
ID: Paeonia22_contig00011792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00011792 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216139.1| hypothetical protein PRUPE_ppa015009mg [Prun... 75 7e-12 ref|XP_002320532.1| hypothetical protein POPTR_0014s16790g [Popu... 71 2e-10 ref|XP_007049406.1| Uncharacterized protein TCM_002452 [Theobrom... 70 4e-10 ref|XP_002532214.1| conserved hypothetical protein [Ricinus comm... 70 4e-10 ref|XP_002301576.2| hypothetical protein POPTR_0002s22310g [Popu... 69 9e-10 ref|XP_006447833.1| hypothetical protein CICLE_v10017528mg [Citr... 68 1e-09 gb|EYU42785.1| hypothetical protein MIMGU_mgv1a021450mg [Mimulus... 65 7e-09 >ref|XP_007216139.1| hypothetical protein PRUPE_ppa015009mg [Prunus persica] gi|462412289|gb|EMJ17338.1| hypothetical protein PRUPE_ppa015009mg [Prunus persica] Length = 230 Score = 75.5 bits (184), Expect = 7e-12 Identities = 38/66 (57%), Positives = 47/66 (71%) Frame = +3 Query: 48 SSEIFMRYPSFFLVRSEVFRRSWDSVVYPE*ILTPGEKLFLVLRHTVRKLRRRLKYPPIM 227 +++I +YPSF L R EVFRR WDSVV + ILTPG+K+ LV R TVRKLRRR++ P Sbjct: 58 AAKILEKYPSFLLARPEVFRRPWDSVVKADEILTPGQKVLLVPRRTVRKLRRRIRKPNKE 117 Query: 228 MSSNLY 245 S N Y Sbjct: 118 FSVNSY 123 >ref|XP_002320532.1| hypothetical protein POPTR_0014s16790g [Populus trichocarpa] gi|222861305|gb|EEE98847.1| hypothetical protein POPTR_0014s16790g [Populus trichocarpa] Length = 238 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/63 (53%), Positives = 45/63 (71%) Frame = +3 Query: 48 SSEIFMRYPSFFLVRSEVFRRSWDSVVYPE*ILTPGEKLFLVLRHTVRKLRRRLKYPPIM 227 ++ I +YPS +L + EVFRR WDSVV E IL PG+K LV RHTV+KLRR+++ P Sbjct: 56 AARILEKYPSHYLAKPEVFRRPWDSVVRREKILIPGQKFLLVPRHTVKKLRRKIRQPSKE 115 Query: 228 MSS 236 +SS Sbjct: 116 LSS 118 >ref|XP_007049406.1| Uncharacterized protein TCM_002452 [Theobroma cacao] gi|508701667|gb|EOX93563.1| Uncharacterized protein TCM_002452 [Theobroma cacao] Length = 274 Score = 69.7 bits (169), Expect = 4e-10 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = +3 Query: 57 IFMRYPSFFLVRSEVFRRSWDSVVYPE*ILTPGEKLFLVLRHTVRKLRRRLKYP 218 I +YPS L R EVFRR WDS+V + ILTPGEK ++V R TVRKLRRR+K P Sbjct: 101 IMNKYPSSILARPEVFRRPWDSLVRSDEILTPGEKFYVVPRRTVRKLRRRIKKP 154 >ref|XP_002532214.1| conserved hypothetical protein [Ricinus communis] gi|223528110|gb|EEF30183.1| conserved hypothetical protein [Ricinus communis] Length = 216 Score = 69.7 bits (169), Expect = 4e-10 Identities = 37/69 (53%), Positives = 44/69 (63%) Frame = +3 Query: 57 IFMRYPSFFLVRSEVFRRSWDSVVYPE*ILTPGEKLFLVLRHTVRKLRRRLKYPPIMMSS 236 I +YPS+ L + EVFRR WDSVV PE ILTPG K LV TV+KLRRR+K P + Sbjct: 56 ILEKYPSYVLAKPEVFRRPWDSVVRPEKILTPGRKFLLVPLRTVKKLRRRVKKPSKDLFG 115 Query: 237 NLYSLLPGS 263 + S GS Sbjct: 116 SSVSQASGS 124 >ref|XP_002301576.2| hypothetical protein POPTR_0002s22310g [Populus trichocarpa] gi|550345580|gb|EEE80849.2| hypothetical protein POPTR_0002s22310g [Populus trichocarpa] Length = 248 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/68 (52%), Positives = 44/68 (64%) Frame = +3 Query: 48 SSEIFMRYPSFFLVRSEVFRRSWDSVVYPE*ILTPGEKLFLVLRHTVRKLRRRLKYPPIM 227 ++ I +YPS L + EVFRR W+SVV PE ILTPG K LV H VRKLRR++ P Sbjct: 56 AARILEKYPSHALAKPEVFRRPWNSVVRPEKILTPGHKFLLVPHHAVRKLRRKIGKPSEE 115 Query: 228 MSSNLYSL 251 SS+ SL Sbjct: 116 SSSSSVSL 123 >ref|XP_006447833.1| hypothetical protein CICLE_v10017528mg [Citrus clementina] gi|557550444|gb|ESR61073.1| hypothetical protein CICLE_v10017528mg [Citrus clementina] Length = 201 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/52 (69%), Positives = 39/52 (75%) Frame = +3 Query: 57 IFMRYPSFFLVRSEVFRRSWDSVVYPE*ILTPGEKLFLVLRHTVRKLRRRLK 212 I +YPS L R EVFRR WDSVV PE +LT GEK FLV R TVRKLRRR+K Sbjct: 58 ILEKYPSCKLGRREVFRRPWDSVVRPEELLTLGEKFFLVPRRTVRKLRRRVK 109 >gb|EYU42785.1| hypothetical protein MIMGU_mgv1a021450mg [Mimulus guttatus] Length = 191 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +3 Query: 48 SSEIFMRYPSFFLVRSEVFRRSWDSVVYPE*ILTPGEKLFLVLRHTVRKLRRRLK 212 +S I +YPSF L R EVF R W+SVV P+ +L PG+K ++V TVRKLRRR+K Sbjct: 42 ASTIIEKYPSFILARPEVFLRPWESVVRPDEMLVPGQKYYVVPSRTVRKLRRRIK 96