BLASTX nr result
ID: Paeonia22_contig00001937
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia22_contig00001937 (644 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005059336.1| PREDICTED: proline-rich protein 2-like [Fice... 59 1e-06 >ref|XP_005059336.1| PREDICTED: proline-rich protein 2-like [Ficedula albicollis] Length = 466 Score = 59.3 bits (142), Expect = 1e-06 Identities = 40/111 (36%), Positives = 48/111 (43%), Gaps = 2/111 (1%) Frame = +1 Query: 277 EHPQAPAGT--HPIRPHGTPVDSAIPQTRPHAPANTTADSFSTGTHPARPPGIPADLGYE 450 EHP+AP T H P P DS Q+ P P A S G HP+ P IP D Sbjct: 207 EHPRAPQNTPEHSRAPQDIPEDSRASQSTPEHPR---APQSSPG-HPSAPQDIPEDSRAS 262 Query: 451 THAPVKPLTHTSVPGIHQTGVPDLPTKVDRGQEIAVDPSAPKDRHDTHTPS 603 P P S PG H +G D+P Q I P AP+ H T +P+ Sbjct: 263 QSTPEHPRAPQSSPG-HPSGPQDIPEDSSAPQSIPEHPRAPRASHSTQSPA 312