BLASTX nr result
ID: Ophiopogon27_contig00055592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00055592 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020696580.1| protein PHR1-LIKE 2-like [Dendrobium catenatum] 59 4e-08 gb|ONK58417.1| uncharacterized protein A4U43_C09F12260 [Asparagu... 60 9e-08 ref|XP_020245915.1| LOW QUALITY PROTEIN: protein PHR1-LIKE 3-lik... 60 1e-07 gb|PKA62084.1| Myb family transcription factor APL [Apostasia sh... 60 1e-07 ref|XP_020570597.1| transcription factor LUX-like [Phalaenopsis ... 59 1e-07 ref|XP_020585310.1| protein PHR1-LIKE 2-like [Phalaenopsis eques... 59 3e-07 ref|XP_020703449.1| protein PHR1-LIKE 3-like isoform X2 [Dendrob... 59 4e-07 ref|XP_020703448.1| protein PHR1-LIKE 3-like isoform X1 [Dendrob... 59 4e-07 ref|XP_009609405.1| PREDICTED: myb family transcription factor P... 55 7e-07 gb|PIA58847.1| hypothetical protein AQUCO_00500644v1 [Aquilegia ... 58 8e-07 ref|XP_009609404.1| PREDICTED: myb family transcription factor P... 55 1e-06 dbj|GAU48291.1| hypothetical protein TSUD_236610 [Trifolium subt... 54 2e-06 ref|XP_015872708.1| PREDICTED: myb family transcription factor A... 54 2e-06 ref|XP_015872707.1| PREDICTED: myb family transcription factor A... 54 2e-06 gb|PKI65557.1| hypothetical protein CRG98_014057 [Punica granatum] 54 2e-06 gb|OAP17677.1| hypothetical protein AXX17_AT1G74220 [Arabidopsis... 54 3e-06 ref|XP_006857597.1| protein PHR1-LIKE 2 [Amborella trichopoda] >... 57 3e-06 dbj|BAF15670.1| Os04g0600000 [Oryza sativa Japonica Group] >gi|9... 54 3e-06 gb|EPS69080.1| hypothetical protein M569_05688, partial [Genlise... 55 3e-06 gb|AFK33486.1| unknown [Medicago truncatula] 54 3e-06 >ref|XP_020696580.1| protein PHR1-LIKE 2-like [Dendrobium catenatum] Length = 141 Score = 59.3 bits (142), Expect = 4e-08 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R+MNI+GLTLYHLKSHLQKYRM Sbjct: 56 ATPKTIMRLMNIKGLTLYHLKSHLQKYRM 84 >gb|ONK58417.1| uncharacterized protein A4U43_C09F12260 [Asparagus officinalis] Length = 230 Score = 60.1 bits (144), Expect = 9e-08 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTILR+MNIRGLTLYHLKSHLQKYR+ Sbjct: 29 ATPKTILRLMNIRGLTLYHLKSHLQKYRL 57 >ref|XP_020245915.1| LOW QUALITY PROTEIN: protein PHR1-LIKE 3-like [Asparagus officinalis] Length = 246 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTILR+MNIRGLTLYHLKSHLQKYR+ Sbjct: 45 ATPKTILRLMNIRGLTLYHLKSHLQKYRL 73 >gb|PKA62084.1| Myb family transcription factor APL [Apostasia shenzhenica] Length = 294 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+RIMNI+GLTLYHLKSHLQKYRM Sbjct: 56 ATPKTIMRIMNIKGLTLYHLKSHLQKYRM 84 >ref|XP_020570597.1| transcription factor LUX-like [Phalaenopsis equestris] Length = 169 Score = 58.5 bits (140), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPK ILRIMN++GLTLYHLKSHLQKYRM Sbjct: 52 ATPKAILRIMNVKGLTLYHLKSHLQKYRM 80 >ref|XP_020585310.1| protein PHR1-LIKE 2-like [Phalaenopsis equestris] Length = 281 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R+MNI+GLTLYHLKSHLQKYRM Sbjct: 56 ATPKTIMRLMNIKGLTLYHLKSHLQKYRM 84 >ref|XP_020703449.1| protein PHR1-LIKE 3-like isoform X2 [Dendrobium catenatum] Length = 254 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPK ILRIMN++GLTLYHLKSHLQKYRM Sbjct: 52 ATPKAILRIMNVKGLTLYHLKSHLQKYRM 80 >ref|XP_020703448.1| protein PHR1-LIKE 3-like isoform X1 [Dendrobium catenatum] gb|PKU81660.1| Myb family transcription factor APL [Dendrobium catenatum] Length = 257 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPK ILRIMN++GLTLYHLKSHLQKYRM Sbjct: 52 ATPKAILRIMNVKGLTLYHLKSHLQKYRM 80 >ref|XP_009609405.1| PREDICTED: myb family transcription factor PHL8-like isoform X2 [Nicotiana tomentosiformis] Length = 115 Score = 55.5 bits (132), Expect = 7e-07 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPK+++R+MNI GLTLYHLKSHLQKYR+ Sbjct: 47 ATPKSLMRVMNIHGLTLYHLKSHLQKYRL 75 >gb|PIA58847.1| hypothetical protein AQUCO_00500644v1 [Aquilegia coerulea] Length = 267 Score = 57.8 bits (138), Expect = 8e-07 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = -3 Query: 137 YCIMRKXXXXXXXXXEATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 YC+M EATPK++LR+M ++GLTLYHLKSHLQKYR+ Sbjct: 12 YCLMLLSSLLYSIITEATPKSVLRVMGLKGLTLYHLKSHLQKYRL 56 >ref|XP_009609404.1| PREDICTED: myb family transcription factor PHL8-like isoform X1 [Nicotiana tomentosiformis] Length = 145 Score = 55.5 bits (132), Expect = 1e-06 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPK+++R+MNI GLTLYHLKSHLQKYR+ Sbjct: 47 ATPKSLMRVMNIHGLTLYHLKSHLQKYRL 75 >dbj|GAU48291.1| hypothetical protein TSUD_236610 [Trifolium subterraneum] Length = 94 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPK++LR+M ++GLTLYHLKSHLQKYR+ Sbjct: 48 ATPKSVLRLMGLKGLTLYHLKSHLQKYRL 76 >ref|XP_015872708.1| PREDICTED: myb family transcription factor APL-like isoform X2 [Ziziphus jujuba] Length = 116 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R M ++GLTLYHLKSHLQKYR+ Sbjct: 7 ATPKTIMRTMGVKGLTLYHLKSHLQKYRL 35 >ref|XP_015872707.1| PREDICTED: myb family transcription factor APL-like isoform X1 [Ziziphus jujuba] Length = 120 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R M ++GLTLYHLKSHLQKYR+ Sbjct: 7 ATPKTIMRTMGVKGLTLYHLKSHLQKYRL 35 >gb|PKI65557.1| hypothetical protein CRG98_014057 [Punica granatum] Length = 125 Score = 54.3 bits (129), Expect = 2e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R+M ++GLTLYHLKSHLQK+R+ Sbjct: 59 ATPKTIMRVMGVKGLTLYHLKSHLQKFRL 87 >gb|OAP17677.1| hypothetical protein AXX17_AT1G74220 [Arabidopsis thaliana] Length = 126 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R+M ++GLTLYHLKSHLQK+R+ Sbjct: 60 ATPKTIMRVMGVKGLTLYHLKSHLQKFRL 88 >ref|XP_006857597.1| protein PHR1-LIKE 2 [Amborella trichopoda] gb|ERN19064.1| hypothetical protein AMTR_s00061p00096800 [Amborella trichopoda] Length = 329 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R MN++GLTLYHLKSHLQKYR+ Sbjct: 66 ATPKTIMRTMNVKGLTLYHLKSHLQKYRL 94 >dbj|BAF15670.1| Os04g0600000 [Oryza sativa Japonica Group] dbj|BAS90828.1| Os04g0600000 [Oryza sativa Japonica Group] Length = 98 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPK++LR+M ++GLTLYHLKSHLQKYR+ Sbjct: 47 ATPKSVLRLMGMKGLTLYHLKSHLQKYRL 75 >gb|EPS69080.1| hypothetical protein M569_05688, partial [Genlisea aurea] Length = 193 Score = 55.5 bits (132), Expect = 3e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R M ++GLTLYHLKSHLQKYRM Sbjct: 64 ATPKTIMRTMGVKGLTLYHLKSHLQKYRM 92 >gb|AFK33486.1| unknown [Medicago truncatula] Length = 135 Score = 54.3 bits (129), Expect = 3e-06 Identities = 22/29 (75%), Positives = 28/29 (96%) Frame = -3 Query: 89 ATPKTILRIMNIRGLTLYHLKSHLQKYRM 3 ATPKTI+R+M ++GLTLYHLKSHLQK+R+ Sbjct: 61 ATPKTIMRVMGVKGLTLYHLKSHLQKFRL 89