BLASTX nr result
ID: Ophiopogon27_contig00055426
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00055426 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKK59106.1| hypothetical protein RhiirC2_857505 [Rhizophagus ... 138 3e-35 gb|PKY52633.1| hypothetical protein RhiirA4_470388 [Rhizophagus ... 75 4e-15 >gb|PKK59106.1| hypothetical protein RhiirC2_857505 [Rhizophagus irregularis] Length = 653 Score = 138 bits (347), Expect = 3e-35 Identities = 74/107 (69%), Positives = 84/107 (78%), Gaps = 1/107 (0%) Frame = -3 Query: 430 AEGIVNFLQTGNERLTILRRWFISLS*IFWKGMKQKKSRIDEQEKEAEDANKNESVADNK 251 AEGIVNFLQTGNERL + F + + K+SRIDE+EKEAEDANKN+SV +NK Sbjct: 213 AEGIVNFLQTGNERLNDTSKMVHKSQLNFLERDEAKRSRIDEEEKEAEDANKNKSVENNK 272 Query: 250 PYDLREKQNINYNEEYLSKKQCGYTLPSPGSQTIHP-LPMDNSFSEK 113 Y+LRE+ NINYNEE LSKKQCGYT PSPGS T+HP LPMDNSFSEK Sbjct: 273 -YNLRERGNINYNEECLSKKQCGYTTPSPGSPTLHPLLPMDNSFSEK 318 >gb|PKY52633.1| hypothetical protein RhiirA4_470388 [Rhizophagus irregularis] Length = 130 Score = 74.7 bits (182), Expect(2) = 4e-15 Identities = 41/72 (56%), Positives = 53/72 (73%), Gaps = 1/72 (1%) Frame = -3 Query: 325 KKSRIDEQEKEAEDAN-KNESVADNKPYDLREKQNINYNEEYLSKKQCGYTLPSPGSQTI 149 KK RI+EQEKEA+ KNESVA+NKPYDLREK+ + + KKQC Y + S GSQT+ Sbjct: 16 KKFRINEQEKEAKILILKNESVANNKPYDLREKKILITIKNICQKKQCRYIISSLGSQTL 75 Query: 148 HPLPMDNSFSEK 113 + L +DNSFS++ Sbjct: 76 YLLSIDNSFSKE 87 Score = 34.3 bits (77), Expect(2) = 4e-15 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = -2 Query: 371 MVHKSQLNFLERNEAKKIQ 315 M+HKS LNFLERNE KK + Sbjct: 1 MIHKSHLNFLERNEVKKFR 19