BLASTX nr result
ID: Ophiopogon27_contig00055310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ophiopogon27_contig00055310 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKC54418.1| hypothetical protein RhiirA1_477346 [Rhizophagus ... 55 5e-06 >gb|PKC54418.1| hypothetical protein RhiirA1_477346 [Rhizophagus irregularis] Length = 434 Score = 55.1 bits (131), Expect = 5e-06 Identities = 29/61 (47%), Positives = 38/61 (62%), Gaps = 3/61 (4%) Frame = +2 Query: 212 CCYR*ELYIKFA---GYHILTSGTRASYIIDG*LPNTKDTAFRSESLLYMLTSLDRIIVE 382 CCY ELYI FA GY+I+ SG LP+ KD F++ SL+Y+L +LDRII + Sbjct: 332 CCYLCELYINFAIKQGYNIVVSGKHGKIYSKWILPHVKDNNFKARSLIYILENLDRIIEK 391 Query: 383 K 385 K Sbjct: 392 K 392